Detailed information    

insolico Bioinformatically predicted

Overview

Name   dprA   Type   Machinery gene
Locus tag   PYH74_RS07595 Genome accession   NZ_CP118814
Coordinates   1615934..1616806 (-) Length   290 a.a.
NCBI ID   WP_001829468.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain 7060     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1577476..1648350 1615934..1616806 within 0


Gene organization within MGE regions


Location: 1577476..1648350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYH74_RS07450 (PYH74_07450) - 1578516..1579787 (-) 1272 WP_002439538.1 pitrilysin family protein -
  PYH74_RS07455 (PYH74_07455) - 1579818..1580531 (-) 714 WP_002439536.1 GntR family transcriptional regulator -
  PYH74_RS07460 (PYH74_07460) - 1580534..1582927 (-) 2394 WP_002439534.1 DNA translocase FtsK -
  PYH74_RS07465 (PYH74_07465) - 1583193..1584836 (-) 1644 WP_032601905.1 ribonuclease J -
  PYH74_RS07470 (PYH74_07470) pnp 1585233..1587338 (-) 2106 WP_001832554.1 polyribonucleotide nucleotidyltransferase -
  PYH74_RS07475 (PYH74_07475) rpsO 1587470..1587739 (-) 270 WP_002439528.1 30S ribosomal protein S15 -
  PYH74_RS07480 (PYH74_07480) - 1587859..1588830 (-) 972 WP_001832563.1 bifunctional riboflavin kinase/FAD synthetase -
  PYH74_RS07485 (PYH74_07485) truB 1588846..1589763 (-) 918 WP_002456563.1 tRNA pseudouridine(55) synthase TruB -
  PYH74_RS07490 (PYH74_07490) rbfA 1589901..1590251 (-) 351 WP_001829509.1 30S ribosome-binding factor RbfA -
  PYH74_RS07495 (PYH74_07495) infB 1590554..1592716 (-) 2163 WP_002468903.1 translation initiation factor IF-2 -
  PYH74_RS07500 (PYH74_07500) - 1592721..1593038 (-) 318 WP_002439520.1 YlxQ family RNA-binding protein -
  PYH74_RS07505 (PYH74_07505) - 1593038..1593322 (-) 285 WP_001829465.1 YlxR family protein -
  PYH74_RS07510 (PYH74_07510) nusA 1593340..1594563 (-) 1224 WP_002456565.1 transcription termination factor NusA -
  PYH74_RS07515 (PYH74_07515) rimP 1594584..1595051 (-) 468 WP_002439519.1 ribosome maturation factor RimP -
  PYH74_RS07520 (PYH74_07520) - 1595230..1599540 (-) 4311 WP_002456566.1 PolC-type DNA polymerase III -
  PYH74_RS07525 (PYH74_07525) - 1599790..1601493 (-) 1704 WP_001829513.1 proline--tRNA ligase -
  PYH74_RS07530 (PYH74_07530) rseP 1601512..1602798 (-) 1287 WP_001829501.1 RIP metalloprotease RseP -
  PYH74_RS07535 (PYH74_07535) - 1603032..1603814 (-) 783 WP_001829499.1 phosphatidate cytidylyltransferase -
  PYH74_RS07540 (PYH74_07540) - 1603818..1604588 (-) 771 WP_001832561.1 isoprenyl transferase -
  PYH74_RS07545 (PYH74_07545) frr 1604809..1605363 (-) 555 WP_001829472.1 ribosome recycling factor -
  PYH74_RS07550 (PYH74_07550) pyrH 1605380..1606102 (-) 723 WP_002439511.1 UMP kinase -
  PYH74_RS07555 (PYH74_07555) tsf 1606243..1607121 (-) 879 WP_002439509.1 translation elongation factor Ts -
  PYH74_RS07560 (PYH74_07560) rpsB 1607273..1608061 (-) 789 WP_001832557.1 30S ribosomal protein S2 -
  PYH74_RS07565 (PYH74_07565) codY 1608420..1609193 (-) 774 WP_002446289.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  PYH74_RS07570 (PYH74_07570) hslU 1609217..1610620 (-) 1404 WP_002469380.1 ATP-dependent protease ATPase subunit HslU -
  PYH74_RS07575 (PYH74_07575) hslV 1610689..1611231 (-) 543 WP_001829498.1 ATP-dependent protease subunit HslV -
  PYH74_RS07580 (PYH74_07580) xerC 1611235..1612125 (-) 891 WP_002456225.1 tyrosine recombinase XerC -
  PYH74_RS07585 (PYH74_07585) trmFO 1612350..1613657 (-) 1308 WP_001832560.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  PYH74_RS07590 (PYH74_07590) topA 1613682..1615751 (-) 2070 WP_001829508.1 type I DNA topoisomerase -
  PYH74_RS07595 (PYH74_07595) dprA 1615934..1616806 (-) 873 WP_001829468.1 DNA-processing protein DprA Machinery gene
  PYH74_RS07600 (PYH74_07600) - 1617147..1617362 (-) 216 Protein_1462 IS200/IS605 family transposase -
  PYH74_RS07605 (PYH74_07605) sucD 1617612..1618520 (-) 909 WP_002446283.1 succinate--CoA ligase subunit alpha -
  PYH74_RS07610 (PYH74_07610) sucC 1618542..1619708 (-) 1167 WP_002456569.1 ADP-forming succinate--CoA ligase subunit beta -
  PYH74_RS07615 (PYH74_07615) - 1619816..1620586 (-) 771 WP_001829514.1 ribonuclease HII -
  PYH74_RS07620 (PYH74_07620) ylqF 1620591..1621454 (-) 864 WP_001829495.1 ribosome biogenesis GTPase YlqF -
  PYH74_RS07625 (PYH74_07625) - 1621475..1621624 (-) 150 WP_162154119.1 hypothetical protein -
  PYH74_RS07630 (PYH74_07630) - 1621783..1624383 (+) 2601 WP_002456571.1 YfhO family protein -
  PYH74_RS07635 (PYH74_07635) - 1624376..1626979 (+) 2604 WP_002456572.1 YfhO family protein -
  PYH74_RS07640 (PYH74_07640) rplS 1627509..1627859 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  PYH74_RS07645 (PYH74_07645) trmD 1627965..1628702 (-) 738 WP_001829466.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  PYH74_RS07650 (PYH74_07650) rimM 1628702..1629205 (-) 504 WP_001832559.1 ribosome maturation factor RimM -
  PYH74_RS07655 (PYH74_07655) rpsP 1629332..1629607 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  PYH74_RS07660 (PYH74_07660) ffh 1629915..1631282 (-) 1368 WP_001830113.1 signal recognition particle protein -
  PYH74_RS07665 (PYH74_07665) - 1631313..1631645 (-) 333 WP_002457379.1 putative DNA-binding protein -
  PYH74_RS07670 (PYH74_07670) ftsY 1631647..1632873 (-) 1227 WP_002456573.1 signal recognition particle-docking protein FtsY -
  PYH74_RS07675 (PYH74_07675) smc 1632870..1636439 (-) 3570 WP_282888216.1 chromosome segregation protein SMC -
  PYH74_RS07680 (PYH74_07680) rnc 1636566..1637303 (-) 738 WP_002456575.1 ribonuclease III -
  PYH74_RS07685 (PYH74_07685) - 1637418..1637651 (-) 234 WP_001830184.1 acyl carrier protein -
  PYH74_RS07690 (PYH74_07690) fabG 1637879..1638613 (-) 735 WP_001830161.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  PYH74_RS07695 (PYH74_07695) fabD 1638606..1639532 (-) 927 WP_002469385.1 ACP S-malonyltransferase -
  PYH74_RS07700 (PYH74_07700) plsX 1639534..1640511 (-) 978 WP_002469384.1 phosphate acyltransferase PlsX -
  PYH74_RS07705 (PYH74_07705) fapR 1640513..1641073 (-) 561 WP_001830099.1 transcription factor FapR -
  PYH74_RS07710 (PYH74_07710) recG 1641232..1643280 (-) 2049 WP_002456579.1 ATP-dependent DNA helicase RecG -
  PYH74_RS07715 (PYH74_07715) fakA 1643484..1645142 (-) 1659 WP_002456580.1 fatty acid kinase catalytic subunit FakA -
  PYH74_RS07720 (PYH74_07720) - 1645157..1645531 (-) 375 WP_001830156.1 Asp23/Gls24 family envelope stress response protein -
  PYH74_RS07725 (PYH74_07725) rpmB 1645889..1646077 (+) 189 WP_001830107.1 50S ribosomal protein L28 -
  PYH74_RS07730 (PYH74_07730) - 1646160..1646795 (-) 636 WP_001830164.1 thiamine diphosphokinase -
  PYH74_RS07735 (PYH74_07735) rpe 1646800..1647444 (-) 645 WP_001830173.1 ribulose-phosphate 3-epimerase -
  PYH74_RS07740 (PYH74_07740) rsgA 1647445..1648320 (-) 876 WP_002469378.1 ribosome small subunit-dependent GTPase A -

Sequence

Protein


Download         Length: 290 a.a.        Molecular weight: 33726.62 Da        Isoelectric Point: 9.3618

>NTDB_id=795541 PYH74_RS07595 WP_001829468.1 1615934..1616806(-) (dprA) [Staphylococcus epidermidis strain 7060]
MIQHTMLKLYWANFTTAQLHHLTSTYPDFLSENVFHQHDMIKRWLTERNSERLWNKYERFKELKLMDIIKEMKKANVSFT
TYFDDNYPSLCKEMYDYPYVIFYKGNPQFFNHSHSLAVIGSRNATQYTSQSLNYLFPSFRQLNMAIVSGLARGADSVAHQ
TALKYLLPTIGVLGFGHCYHYPKATLNLRTKVERNGLVISEYPPFSPISKHKFPERNRLISGLSRGVLITEAEERSGSQI
TIDCALEQNRNVYVLPGSMFNKMTKGNLRRINEGAQVVIDESSILYDYLF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=795541 PYH74_RS07595 WP_001829468.1 1615934..1616806(-) (dprA) [Staphylococcus epidermidis strain 7060]
TTGATACAACATACGATGTTAAAACTATATTGGGCAAATTTCACTACGGCACAACTTCATCATCTTACAAGTACATATCC
TGACTTTCTATCAGAAAACGTATTTCATCAACATGACATGATAAAAAGGTGGCTTACAGAGCGTAATTCTGAAAGGCTAT
GGAACAAATATGAACGTTTCAAAGAATTAAAGCTGATGGACATTATTAAAGAAATGAAAAAAGCAAATGTTAGTTTTACA
ACATACTTTGATGATAACTACCCTTCTCTTTGCAAAGAAATGTATGATTATCCTTATGTGATATTCTACAAAGGAAATCC
ACAGTTCTTTAATCATTCTCACTCTTTAGCTGTAATTGGCTCACGTAATGCCACACAATATACAAGTCAATCTTTAAACT
ATCTTTTTCCTTCATTTAGACAATTAAATATGGCGATTGTTTCTGGATTAGCGCGCGGTGCAGATAGTGTAGCACATCAA
ACCGCACTTAAATACCTATTACCAACTATTGGCGTACTTGGATTTGGCCATTGTTATCATTATCCTAAAGCAACCTTAAA
TTTAAGAACTAAAGTTGAAAGGAATGGCTTAGTGATAAGTGAATATCCACCATTTTCTCCTATAAGTAAGCATAAATTTC
CTGAAAGAAACAGGCTTATAAGTGGTCTGTCCAGAGGGGTACTTATAACTGAGGCTGAAGAAAGAAGTGGTAGTCAAATC
ACTATCGATTGTGCTTTAGAGCAAAATAGAAATGTTTATGTTCTACCTGGTTCAATGTTCAACAAAATGACTAAAGGTAA
TTTAAGAAGGATAAATGAAGGTGCTCAAGTTGTTATAGATGAAAGTAGTATATTATATGATTATCTATTTTAG

Domains

Predicted by InterproScan.

DNA recombination-mediator protein A (DNA_processg_A)

(72-279)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus N315

56.944

99.31

0.566
  dprA Staphylococcus aureus MW2

56.944

99.31

0.566