Detailed information    

insolico Bioinformatically predicted

Overview


Name   vraR   Type   Regulator
Locus tag   PYH57_RS10365 Genome accession   NZ_CP118810
Coordinates   2060756..2061385 (-) Length   209 a.a.
NCBI ID   WP_000153530.1    Uniprot ID   D9IFM7
Organism   Staphylococcus aureus strain 7062     
Function   repress expression of competence genes (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2053678..2088378 2060756..2061385 within 0


Gene organization within MGE regions


Location: 2053678..2088378
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PYH57_RS10325 (PYH57_10315) - 2053678..2054724 (+) 1047 WP_353295320.1 tyrosine-type recombinase/integrase -
  PYH57_RS10330 (PYH57_10320) yfkAB 2054769..2055914 (+) 1146 WP_353458956.1 radical SAM/CxCxxxxC motif protein YfkAB -
  PYH57_RS10335 (PYH57_10325) - 2056174..2056704 (-) 531 WP_000184381.1 acyl-CoA thioesterase -
  PYH57_RS10340 (PYH57_10330) - 2056794..2058050 (-) 1257 WP_250425878.1 aminopeptidase -
  PYH57_RS10345 (PYH57_10335) - 2058053..2058253 (-) 201 WP_000180460.1 DUF1128 family protein -
  PYH57_RS10350 (PYH57_10340) - 2058400..2058864 (+) 465 WP_000228666.1 low molecular weight protein-tyrosine-phosphatase -
  PYH57_RS10355 (PYH57_10345) - 2058871..2059146 (+) 276 WP_000428172.1 YtxH domain-containing protein -
  PYH57_RS10360 (PYH57_10350) - 2059426..2060643 (+) 1218 WP_000037081.1 YihY/virulence factor BrkB family protein -
  PYH57_RS10365 (PYH57_10355) vraR 2060756..2061385 (-) 630 WP_000153530.1 two-component system response regulator VraR Regulator
  PYH57_RS10370 (PYH57_10360) vraS 2061375..2062418 (-) 1044 WP_001017131.1 sensor histidine kinase Regulator
  PYH57_RS10375 (PYH57_10365) liaF 2062415..2063116 (-) 702 WP_000149070.1 cell wall-active antibiotics response protein LiaF -
  PYH57_RS10380 (PYH57_10370) - 2063131..2063517 (-) 387 WP_001110179.1 hypothetical protein -
  PYH57_RS10385 (PYH57_10375) map 2063734..2064492 (-) 759 WP_111014375.1 type I methionyl aminopeptidase -
  PYH57_RS10390 (PYH57_10380) - 2065078..2066064 (+) 987 WP_000999713.1 aromatic acid exporter family protein -
  PYH57_RS10395 (PYH57_10385) - 2066253..2066666 (-) 414 WP_025174666.1 hypothetical protein -
  PYH57_RS10400 (PYH57_10390) - 2066695..2066805 (-) 111 WP_001790257.1 hypothetical protein -
  PYH57_RS10405 (PYH57_10395) - 2066891..2067622 (-) 732 WP_000544977.1 type 1 glutamine amidotransferase -
  PYH57_RS10410 (PYH57_10400) murT 2067624..2068937 (-) 1314 WP_001250333.1 lipid II isoglutaminyl synthase subunit MurT -
  PYH57_RS10415 (PYH57_10405) ftnA 2069229..2069729 (+) 501 WP_000949467.1 H-type ferritin FtnA -
  PYH57_RS10420 (PYH57_10410) - 2069811..2069903 (-) 93 WP_001790679.1 hypothetical protein -
  PYH57_RS10425 (PYH57_10415) - 2070120..2070674 (+) 555 WP_000613738.1 3'-5' exonuclease -
  PYH57_RS10430 (PYH57_10420) dinB 2070741..2071811 (-) 1071 WP_000140176.1 DNA polymerase IV -
  PYH57_RS10435 (PYH57_10425) - 2072057..2072587 (-) 531 WP_000548781.1 DUF3267 domain-containing protein -
  PYH57_RS10440 (PYH57_10430) rlmD 2072757..2074118 (-) 1362 WP_001147861.1 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD -
  PYH57_RS10445 (PYH57_10435) - 2074199..2075146 (-) 948 WP_001231462.1 diacylglycerol kinase -
  PYH57_RS10450 (PYH57_10440) - 2075839..2075985 (-) 147 WP_000225074.1 hypothetical protein -
  PYH57_RS10455 (PYH57_10445) gatB 2076024..2077451 (-) 1428 WP_000545370.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB -
  PYH57_RS10460 (PYH57_10450) gatA 2077464..2078921 (-) 1458 WP_000027928.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatA -
  PYH57_RS10465 (PYH57_10455) gatC 2078923..2079225 (-) 303 WP_000170162.1 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatC -
  PYH57_RS10470 (PYH57_10460) putP 2079591..2081129 (+) 1539 WP_000957020.1 sodium/proline symporter PutP -
  PYH57_RS10475 (PYH57_10465) - 2081288..2081641 (-) 354 WP_000238681.1 winged helix-turn-helix transcriptional regulator -
  PYH57_RS10480 (PYH57_10470) - 2081766..2082725 (+) 960 WP_000431628.1 nitronate monooxygenase -
  PYH57_RS10485 (PYH57_10475) - 2082967..2084166 (-) 1200 WP_250425880.1 CamS family sex pheromone protein -
  PYH57_RS10490 (PYH57_10480) ligA 2084179..2086182 (-) 2004 WP_000774565.1 NAD-dependent DNA ligase LigA -
  PYH57_RS10495 (PYH57_10485) pcrA 2086186..2088378 (-) 2193 WP_262633472.1 DNA helicase PcrA -

Sequence


Protein


Download         Length: 209 a.a.        Molecular weight: 23545.29 Da        Isoelectric Point: 5.3889

>NTDB_id=795475 PYH57_RS10365 WP_000153530.1 2060756..2061385(-) (vraR) [Staphylococcus aureus strain 7062]
MTIKVLFVDDHEMVRIGISSYLSTQSDIEVVGEGASGKEAIAKAHELKPDLILMDLLMDDMDGVEATTQIKKDLPQIKVL
MLTSFIEDKEVYRALDAGVDSYILKTTSAKDIADAVRKTSRGESVFEPEVLVKMRNRMKKRAELYEMLTEREMEILLLIA
KGYSNQEIASASHITIKTVKTHVSNILSKLEVQDRTQAVIYAFQHNLIQ

Nucleotide


Download         Length: 630 bp        

>NTDB_id=795475 PYH57_RS10365 WP_000153530.1 2060756..2061385(-) (vraR) [Staphylococcus aureus strain 7062]
ATGACGATTAAAGTATTGTTTGTGGATGATCATGAAATGGTACGTATAGGAATTTCAAGTTATCTATCAACGCAAAGTGA
TATTGAAGTAGTTGGTGAAGGCGCTTCTGGTAAAGAAGCAATTGCCAAAGCCCATGAGTTGAAGCCAGATTTAATTTTAA
TGGATTTACTTATGGATGACATGGATGGTGTAGAAGCGACGACTCAGATTAAAAAAGATTTACCGCAAATTAAAGTATTA
ATGTTAACTAGTTTTATTGAAGATAAAGAGGTATATCGTGCATTAGATGCAGGTGTCGATAGTTACATTTTAAAAACAAC
AAGTGCAAAAGATATCGCCGATGCAGTTCGTAAAACTTCTAGAGGAGAATCTGTTTTTGAACCGGAAGTTTTAGTGAAAA
TGCGTAACCGTATGAAAAAGCGCGCAGAGTTATATGAAATGCTTACAGAACGAGAAATGGAAATATTATTATTGATTGCG
AAAGGTTACTCAAATCAAGAAATTGCTAGTGCATCGCATATTACTATTAAAACGGTTAAGACACATGTGAGTAACATTTT
AAGTAAGTTAGAAGTGCAAGATAGAACACAAGCTGTAATCTATGCATTCCAACATAATTTAATTCAATAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB D9IFM7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  vraR Staphylococcus aureus N315

99.522

100

0.995

  degU Bacillus subtilis subsp. subtilis str. 168

34.821

100

0.373