Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   PWO55_RS11975 Genome accession   NZ_CP118770
Coordinates   2442233..2442670 (-) Length   145 a.a.
NCBI ID   WP_044053464.1    Uniprot ID   -
Organism   Bacillus velezensis strain IMD4036     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2437233..2447670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWO55_RS11925 (PWO55_11915) sinI 2437618..2437791 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  PWO55_RS11930 (PWO55_11920) sinR 2437825..2438160 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PWO55_RS11935 (PWO55_11925) tasA 2438208..2438993 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  PWO55_RS11940 (PWO55_11930) sipW 2439057..2439641 (-) 585 WP_046559873.1 signal peptidase I SipW -
  PWO55_RS11945 (PWO55_11935) tapA 2439613..2440284 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  PWO55_RS11950 (PWO55_11940) - 2440543..2440872 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PWO55_RS11955 (PWO55_11945) - 2440912..2441091 (-) 180 WP_003153093.1 YqzE family protein -
  PWO55_RS11960 (PWO55_11950) comGG 2441148..2441525 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  PWO55_RS11965 (PWO55_11955) comGF 2441526..2441921 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PWO55_RS11970 (PWO55_11960) comGE 2441935..2442249 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PWO55_RS11975 (PWO55_11965) comGD 2442233..2442670 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene
  PWO55_RS11980 (PWO55_11970) comGC 2442660..2442968 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  PWO55_RS11985 (PWO55_11975) comGB 2442973..2444010 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  PWO55_RS11990 (PWO55_11980) comGA 2443997..2445067 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  PWO55_RS11995 (PWO55_11985) - 2445259..2446209 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  PWO55_RS12000 (PWO55_11990) - 2446355..2447656 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16282.81 Da        Isoelectric Point: 10.3354

>NTDB_id=795053 PWO55_RS11975 WP_044053464.1 2442233..2442670(-) (comGD) [Bacillus velezensis strain IMD4036]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=795053 PWO55_RS11975 WP_044053464.1 2442233..2442670(-) (comGD) [Bacillus velezensis strain IMD4036]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACTCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566