Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PWO55_RS11925 Genome accession   NZ_CP118770
Coordinates   2437618..2437791 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain IMD4036     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2432618..2442791
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PWO55_RS11910 (PWO55_11900) gcvT 2433435..2434535 (-) 1101 WP_207579557.1 glycine cleavage system aminomethyltransferase GcvT -
  PWO55_RS11915 (PWO55_11905) - 2434959..2436629 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  PWO55_RS11920 (PWO55_11910) - 2436647..2437441 (+) 795 WP_003153106.1 YqhG family protein -
  PWO55_RS11925 (PWO55_11915) sinI 2437618..2437791 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  PWO55_RS11930 (PWO55_11920) sinR 2437825..2438160 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PWO55_RS11935 (PWO55_11925) tasA 2438208..2438993 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  PWO55_RS11940 (PWO55_11930) sipW 2439057..2439641 (-) 585 WP_046559873.1 signal peptidase I SipW -
  PWO55_RS11945 (PWO55_11935) tapA 2439613..2440284 (-) 672 WP_046559874.1 amyloid fiber anchoring/assembly protein TapA -
  PWO55_RS11950 (PWO55_11940) - 2440543..2440872 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  PWO55_RS11955 (PWO55_11945) - 2440912..2441091 (-) 180 WP_003153093.1 YqzE family protein -
  PWO55_RS11960 (PWO55_11950) comGG 2441148..2441525 (-) 378 WP_046559875.1 competence type IV pilus minor pilin ComGG Machinery gene
  PWO55_RS11965 (PWO55_11955) comGF 2441526..2441921 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PWO55_RS11970 (PWO55_11960) comGE 2441935..2442249 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  PWO55_RS11975 (PWO55_11965) comGD 2442233..2442670 (-) 438 WP_044053464.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=795049 PWO55_RS11925 WP_003153105.1 2437618..2437791(+) (sinI) [Bacillus velezensis strain IMD4036]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=795049 PWO55_RS11925 WP_003153105.1 2437618..2437791(+) (sinI) [Bacillus velezensis strain IMD4036]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702