Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   PSR12_RS12645 Genome accession   NZ_CP118397
Coordinates   2492158..2492742 (-) Length   194 a.a.
NCBI ID   WP_274769165.1    Uniprot ID   -
Organism   Lysinibacillus sp. G01H     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2461700..2517520 2492158..2492742 within 0


Gene organization within MGE regions


Location: 2461700..2517520
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PSR12_RS12430 (PSR12_12430) - 2461700..2462371 (-) 672 WP_274769101.1 M15 family metallopeptidase -
  PSR12_RS12435 (PSR12_12435) - 2462368..2462772 (-) 405 WP_274769103.1 phage holin family protein -
  PSR12_RS12440 (PSR12_12440) - 2462837..2463040 (-) 204 WP_274769105.1 hypothetical protein -
  PSR12_RS12445 (PSR12_12445) - 2463125..2463262 (-) 138 WP_274773481.1 XkdX family protein -
  PSR12_RS12450 (PSR12_12450) - 2463262..2463483 (-) 222 WP_274769106.1 hypothetical protein -
  PSR12_RS12455 (PSR12_12455) - 2463483..2466110 (-) 2628 WP_274769108.1 Ig-like domain-containing protein -
  PSR12_RS12460 (PSR12_12460) - 2466113..2466712 (-) 600 WP_274769110.1 hypothetical protein -
  PSR12_RS12465 (PSR12_12465) - 2466705..2467013 (-) 309 WP_274769111.1 hypothetical protein -
  PSR12_RS12470 (PSR12_12470) - 2467010..2467666 (-) 657 WP_274769113.1 putative phage tail protein -
  PSR12_RS12475 (PSR12_12475) - 2467663..2468754 (-) 1092 WP_274769115.1 baseplate J/gp47 family protein -
  PSR12_RS12480 (PSR12_12480) - 2468747..2469163 (-) 417 WP_036075134.1 DUF2634 domain-containing protein -
  PSR12_RS12485 (PSR12_12485) - 2469157..2469597 (-) 441 WP_274769118.1 DUF2577 domain-containing protein -
  PSR12_RS12490 (PSR12_12490) - 2469594..2470559 (-) 966 WP_274769120.1 hypothetical protein -
  PSR12_RS12495 (PSR12_12495) - 2470561..2471259 (-) 699 WP_274769122.1 LysM peptidoglycan-binding domain-containing protein -
  PSR12_RS12500 (PSR12_12500) - 2471256..2473757 (-) 2502 WP_274769123.1 tape measure protein -
  PSR12_RS12505 (PSR12_12505) - 2473826..2474188 (-) 363 WP_036075121.1 hypothetical protein -
  PSR12_RS12510 (PSR12_12510) - 2474433..2474834 (-) 402 WP_036075119.1 phage portal protein -
  PSR12_RS12515 (PSR12_12515) - 2474849..2475316 (-) 468 WP_205443772.1 phage tail tube protein -
  PSR12_RS12520 (PSR12_12520) - 2475334..2476629 (-) 1296 WP_274769128.1 phage tail sheath subtilisin-like domain-containing protein -
  PSR12_RS12525 (PSR12_12525) - 2476629..2476832 (-) 204 WP_274769129.1 hypothetical protein -
  PSR12_RS12530 (PSR12_12530) - 2476780..2477244 (-) 465 WP_274769130.1 DUF6838 family protein -
  PSR12_RS12535 (PSR12_12535) - 2477237..2477635 (-) 399 WP_274769132.1 HK97 gp10 family phage protein -
  PSR12_RS12540 (PSR12_12540) - 2477635..2478027 (-) 393 WP_274769134.1 hypothetical protein -
  PSR12_RS12545 (PSR12_12545) - 2478029..2478373 (-) 345 WP_274769136.1 hypothetical protein -
  PSR12_RS12550 (PSR12_12550) - 2478385..2478567 (-) 183 WP_274769137.1 hypothetical protein -
  PSR12_RS12555 (PSR12_12555) - 2478580..2479596 (-) 1017 WP_274769138.1 major capsid protein -
  PSR12_RS12560 (PSR12_12560) - 2479626..2479940 (-) 315 WP_274769140.1 hypothetical protein -
  PSR12_RS12565 (PSR12_12565) - 2479953..2480540 (-) 588 WP_274769141.1 phage scaffolding protein -
  PSR12_RS12570 (PSR12_12570) - 2480637..2481650 (-) 1014 WP_274769142.1 minor capsid protein -
  PSR12_RS12575 (PSR12_12575) - 2481643..2483088 (-) 1446 WP_274769143.1 phage portal protein -
  PSR12_RS12580 (PSR12_12580) - 2483098..2484408 (-) 1311 WP_274769144.1 PBSX family phage terminase large subunit -
  PSR12_RS12585 (PSR12_12585) terS 2484408..2485199 (-) 792 WP_274769145.1 phage terminase small subunit -
  PSR12_RS12590 (PSR12_12590) - 2485239..2485718 (-) 480 WP_274769146.1 hypothetical protein -
  PSR12_RS12595 (PSR12_12595) - 2485911..2486546 (-) 636 WP_274769148.1 hypothetical protein -
  PSR12_RS12600 (PSR12_12600) - 2486969..2487208 (-) 240 WP_342456105.1 DUF3953 domain-containing protein -
  PSR12_RS12605 (PSR12_12605) - 2487572..2488393 (+) 822 WP_274769150.1 hypothetical protein -
  PSR12_RS12610 (PSR12_12610) - 2488407..2488841 (-) 435 WP_274769152.1 LuxR C-terminal-related transcriptional regulator -
  PSR12_RS12615 (PSR12_12615) - 2488981..2489217 (+) 237 WP_274769154.1 hypothetical protein -
  PSR12_RS12620 (PSR12_12620) - 2489331..2489705 (-) 375 WP_274769156.1 XF1762 family protein -
  PSR12_RS12625 (PSR12_12625) - 2489734..2490165 (-) 432 WP_274769158.1 ASCH domain-containing protein -
  PSR12_RS12630 (PSR12_12630) - 2490146..2490664 (-) 519 WP_257522295.1 hypothetical protein -
  PSR12_RS12635 (PSR12_12635) - 2490676..2491419 (-) 744 WP_274769161.1 hypothetical protein -
  PSR12_RS12640 (PSR12_12640) - 2491422..2491967 (-) 546 WP_274769163.1 Holliday junction resolvase RecU -
  PSR12_RS12645 (PSR12_12645) ssbA 2492158..2492742 (-) 585 WP_274769165.1 single-stranded DNA-binding protein Machinery gene
  PSR12_RS12650 (PSR12_12650) - 2492739..2493038 (-) 300 WP_274769166.1 DUF6877 family protein -
  PSR12_RS12655 (PSR12_12655) - 2493025..2494146 (-) 1122 WP_274769167.1 DNA replication protein DnaD -
  PSR12_RS12660 (PSR12_12660) - 2494161..2494340 (-) 180 WP_274769168.1 hypothetical protein -
  PSR12_RS12665 (PSR12_12665) - 2494337..2495056 (-) 720 WP_274769169.1 ERF family protein -
  PSR12_RS12670 (PSR12_12670) - 2495162..2495320 (-) 159 WP_274769170.1 hypothetical protein -
  PSR12_RS12675 (PSR12_12675) - 2495514..2495648 (-) 135 WP_255409617.1 hypothetical protein -
  PSR12_RS12680 (PSR12_12680) - 2495709..2495984 (-) 276 WP_274769172.1 hypothetical protein -
  PSR12_RS12685 (PSR12_12685) - 2495972..2496250 (-) 279 WP_237898078.1 helix-turn-helix transcriptional regulator -
  PSR12_RS12690 (PSR12_12690) - 2496384..2496692 (-) 309 WP_257522303.1 hypothetical protein -
  PSR12_RS12695 (PSR12_12695) - 2496689..2497411 (-) 723 WP_274769176.1 Rha family transcriptional regulator -
  PSR12_RS12700 (PSR12_12700) - 2497599..2497865 (-) 267 WP_237898081.1 helix-turn-helix transcriptional regulator -
  PSR12_RS12705 (PSR12_12705) - 2497936..2498169 (-) 234 WP_274769178.1 helix-turn-helix transcriptional regulator -
  PSR12_RS12710 (PSR12_12710) - 2498327..2498683 (+) 357 WP_274769179.1 helix-turn-helix transcriptional regulator -
  PSR12_RS12715 (PSR12_12715) - 2499007..2499336 (+) 330 WP_274769180.1 ATP-binding protein -
  PSR12_RS12720 (PSR12_12720) - 2499397..2501079 (+) 1683 WP_274769182.1 hypothetical protein -
  PSR12_RS12725 (PSR12_12725) - 2501105..2502328 (-) 1224 WP_274769183.1 DNA cytosine methyltransferase -
  PSR12_RS12730 (PSR12_12730) - 2502492..2502995 (+) 504 WP_274769185.1 ImmA/IrrE family metallo-endopeptidase -
  PSR12_RS12735 (PSR12_12735) - 2503124..2504302 (+) 1179 WP_274769186.1 site-specific integrase -
  PSR12_RS12740 (PSR12_12740) - 2504503..2505162 (-) 660 WP_274769187.1 DUF4355 domain-containing protein -
  PSR12_RS12745 (PSR12_12745) - 2505368..2505589 (-) 222 WP_066036394.1 hypothetical protein -
  PSR12_RS12750 (PSR12_12750) - 2505731..2506633 (-) 903 WP_274769191.1 phage minor head protein -
  PSR12_RS12755 (PSR12_12755) - 2506744..2506899 (-) 156 WP_274769193.1 hypothetical protein -
  PSR12_RS12760 (PSR12_12760) - 2506899..2507684 (-) 786 WP_274769194.1 phage portal protein -
  PSR12_RS12765 (PSR12_12765) - 2507641..2508150 (-) 510 WP_274769196.1 phage portal protein -
  PSR12_RS12770 (PSR12_12770) - 2508163..2509376 (-) 1214 Protein_2499 PBSX family phage terminase large subunit -
  PSR12_RS12775 (PSR12_12775) - 2509376..2509564 (-) 189 WP_274769198.1 hypothetical protein -
  PSR12_RS12780 (PSR12_12780) terS 2509677..2510195 (-) 519 WP_274769199.1 phage terminase small subunit -
  PSR12_RS12785 (PSR12_12785) - 2510203..2510526 (-) 324 WP_274769201.1 hypothetical protein -
  PSR12_RS12790 (PSR12_12790) - 2510587..2510949 (-) 363 WP_274769202.1 DUF2513 domain-containing protein -
  PSR12_RS12795 (PSR12_12795) - 2511106..2511462 (-) 357 WP_274769203.1 hypothetical protein -
  PSR12_RS12800 (PSR12_12800) - 2511536..2511820 (-) 285 WP_274769204.1 hypothetical protein -
  PSR12_RS12805 (PSR12_12805) - 2511989..2512795 (-) 807 WP_112118264.1 GIY-YIG nuclease family protein -
  PSR12_RS12810 (PSR12_12810) - 2513130..2513366 (-) 237 WP_004230330.1 DUF3953 domain-containing protein -
  PSR12_RS12815 (PSR12_12815) - 2513712..2514104 (-) 393 WP_274769207.1 hypothetical protein -
  PSR12_RS12820 (PSR12_12820) - 2514097..2514312 (-) 216 WP_112118261.1 helix-turn-helix transcriptional regulator -
  PSR12_RS12825 (PSR12_12825) - 2514469..2514903 (-) 435 WP_274769209.1 hypothetical protein -
  PSR12_RS12830 (PSR12_12830) - 2515500..2515736 (+) 237 WP_274769211.1 hypothetical protein -
  PSR12_RS12835 (PSR12_12835) - 2515876..2516367 (+) 492 WP_221682908.1 DUF2798 domain-containing protein -
  PSR12_RS12840 (PSR12_12840) - 2516446..2516667 (-) 222 WP_221682909.1 hypothetical protein -
  PSR12_RS12845 (PSR12_12845) - 2517002..2517520 (-) 519 Protein_2514 terminase small subunit -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 21661.60 Da        Isoelectric Point: 6.4635

>NTDB_id=792409 PSR12_RS12645 WP_274769165.1 2492158..2492742(-) (ssbA) [Lysinibacillus sp. G01H]
MINRVVLVGRLTKDPELRYTPNGIASCRFTVAINRTFANQNGERDADFINCQAWRKAAENLANYQRKGALIGLEGRIQTH
SYEDQNGQRVYTTTVVADSIQFLESRSQASGQQQPNSYSSQQQQHQYGGQAYGNKQPNYASGQSQQQFGGPMPGQGAYQQ
NQPPMNQSSYTRVDEDPFANSRGPIEVSDDDLPF

Nucleotide


Download         Length: 585 bp        

>NTDB_id=792409 PSR12_RS12645 WP_274769165.1 2492158..2492742(-) (ssbA) [Lysinibacillus sp. G01H]
ATGATTAATCGTGTCGTATTAGTTGGCCGTCTTACCAAAGATCCTGAGTTACGTTACACACCGAACGGTATTGCATCTTG
CCGCTTTACAGTAGCCATTAACCGTACATTTGCCAATCAAAATGGTGAGCGTGATGCAGATTTTATTAACTGCCAAGCAT
GGCGTAAAGCAGCTGAAAATCTAGCAAACTATCAGCGCAAAGGGGCACTGATTGGTTTAGAAGGTCGTATTCAAACGCAT
AGTTACGAAGATCAGAATGGACAAAGAGTGTATACCACAACGGTTGTAGCGGACAGTATCCAATTTTTAGAGTCACGTAG
TCAAGCTAGTGGTCAACAGCAGCCTAATTCATATTCATCACAACAGCAACAACATCAATATGGCGGACAAGCTTACGGCA
ACAAACAGCCAAACTATGCCAGTGGGCAATCACAGCAACAATTCGGTGGTCCTATGCCAGGGCAAGGTGCTTATCAGCAA
AATCAGCCGCCTATGAATCAATCTAGCTATACAAGAGTAGATGAGGACCCATTTGCGAATAGTCGAGGACCGATAGAAGT
GTCTGATGATGATTTGCCATTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.969

100

0.49
  ssb Latilactobacillus sakei subsp. sakei 23K

47.423

100

0.474