Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PT671_RS18140 Genome accession   NZ_CP118021
Coordinates   3613839..3614012 (-) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus spizizenii strain B-354     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3608839..3619012
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT671_RS18095 comGE 3609191..3609538 (+) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  PT671_RS18100 comGF 3609564..3609947 (+) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  PT671_RS18105 comGG 3609948..3610322 (+) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  PT671_RS18110 - 3610394..3610573 (+) 180 WP_003226330.1 YqzE family protein -
  PT671_RS18115 - 3610615..3610941 (-) 327 WP_079996407.1 YqzG/YhdC family protein -
  PT671_RS18120 tapA 3611210..3611971 (+) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  PT671_RS18125 sipW 3611955..3612527 (+) 573 WP_003226338.1 signal peptidase I SipW -
  PT671_RS18130 tasA 3612591..3613376 (+) 786 WP_003226340.1 biofilm matrix protein TasA -
  PT671_RS18135 sinR 3613470..3613805 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PT671_RS18140 sinI 3613839..3614012 (-) 174 WP_003226347.1 anti-repressor SinI Regulator
  PT671_RS18145 - 3614198..3614992 (-) 795 WP_003226349.1 YqhG family protein -
  PT671_RS18150 - 3615013..3616686 (-) 1674 WP_003226350.1 DEAD/DEAH box helicase -
  PT671_RS18155 gcvT 3617129..3618217 (+) 1089 WP_003226353.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=789192 PT671_RS18140 WP_003226347.1 3613839..3614012(-) (sinI) [Bacillus spizizenii strain B-354]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=789192 PT671_RS18140 WP_003226347.1 3613839..3614012(-) (sinI) [Bacillus spizizenii strain B-354]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4NQ83

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965