Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   PT671_RS18095 Genome accession   NZ_CP118021
Coordinates   3609191..3609538 (+) Length   115 a.a.
NCBI ID   WP_003226323.1    Uniprot ID   E0U415
Organism   Bacillus spizizenii strain B-354     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 3604191..3614538
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT671_RS18065 - 3604743..3605696 (+) 954 WP_003226308.1 magnesium transporter CorA family protein -
  PT671_RS18070 - 3605759..3606169 (+) 411 WP_032727412.1 CBS domain-containing protein -
  PT671_RS18075 comGA 3606382..3607452 (+) 1071 WP_003226312.1 competence protein ComGA Machinery gene
  PT671_RS18080 comGB 3607439..3608476 (+) 1038 WP_003226315.1 competence type IV pilus assembly protein ComGB Machinery gene
  PT671_RS18085 comGC 3608490..3608786 (+) 297 WP_003226319.1 comG operon protein ComGC Machinery gene
  PT671_RS18090 comGD 3608776..3609207 (+) 432 WP_003226321.1 competence type IV pilus minor pilin ComGD Machinery gene
  PT671_RS18095 comGE 3609191..3609538 (+) 348 WP_003226323.1 competence type IV pilus minor pilin ComGE Machinery gene
  PT671_RS18100 comGF 3609564..3609947 (+) 384 WP_032727308.1 competence type IV pilus minor pilin ComGF Machinery gene
  PT671_RS18105 comGG 3609948..3610322 (+) 375 WP_003226328.1 competence type IV pilus minor pilin ComGG Machinery gene
  PT671_RS18110 - 3610394..3610573 (+) 180 WP_003226330.1 YqzE family protein -
  PT671_RS18115 - 3610615..3610941 (-) 327 WP_079996407.1 YqzG/YhdC family protein -
  PT671_RS18120 tapA 3611210..3611971 (+) 762 WP_003226335.1 amyloid fiber anchoring/assembly protein TapA -
  PT671_RS18125 sipW 3611955..3612527 (+) 573 WP_003226338.1 signal peptidase I SipW -
  PT671_RS18130 tasA 3612591..3613376 (+) 786 WP_003226340.1 biofilm matrix protein TasA -
  PT671_RS18135 sinR 3613470..3613805 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PT671_RS18140 sinI 3613839..3614012 (-) 174 WP_003226347.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 115 a.a.        Molecular weight: 13497.51 Da        Isoelectric Point: 4.3472

>NTDB_id=789188 PT671_RS18095 WP_003226323.1 3609191..3609538(+) (comGE) [Bacillus spizizenii strain B-354]
MWRENKGFSTIETMSALSLWLFLLLTVVPLWDKLIADENMAESREIGYQMMNENISKYMMTGEETEVKMITKNNNNYALK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=789188 PT671_RS18095 WP_003226323.1 3609191..3609538(+) (comGE) [Bacillus spizizenii strain B-354]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTTTGCTGCTGACAGT
CGTTCCTTTGTGGGACAAACTGATAGCTGATGAAAATATGGCGGAATCTCGAGAAATCGGGTACCAAATGATGAATGAAA
ACATTAGCAAATATATGATGACTGGTGAAGAAACTGAGGTGAAAATGATTACAAAGAACAATAATAACTATGCGCTAAAG
TGGGAGGAGGAGGGGGAATATCAAAACGTATGCATATCAGCAGCAGCTTATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB E0U415

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

83.478

100

0.835