Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PT966_RS15525 Genome accession   NZ_CP117945
Coordinates   3131326..3131466 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain ZY1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3126326..3136466
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PT966_RS15500 (PT966_15500) - 3126653..3127036 (-) 384 WP_044052949.1 hotdog fold thioesterase -
  PT966_RS15505 (PT966_15505) comA 3127058..3127702 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  PT966_RS15510 (PT966_15510) - 3127783..3130089 (-) 2307 Protein_2991 sensor histidine kinase -
  PT966_RS15515 (PT966_15515) comX 3130108..3130284 (-) 177 WP_044052947.1 competence pheromone ComX -
  PT966_RS15520 (PT966_15520) - 3130299..3131195 (-) 897 WP_017419425.1 polyprenyl synthetase family protein -
  PT966_RS15525 (PT966_15525) degQ 3131326..3131466 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PT966_RS15530 (PT966_15530) - 3131932..3132273 (+) 342 WP_014305721.1 hypothetical protein -
  PT966_RS15535 (PT966_15535) - 3132280..3133500 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  PT966_RS15540 (PT966_15540) - 3133630..3135096 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  PT966_RS15545 (PT966_15545) - 3135114..3135665 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  PT966_RS15550 (PT966_15550) - 3135762..3136160 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=788444 PT966_RS15525 WP_003152043.1 3131326..3131466(-) (degQ) [Bacillus velezensis strain ZY1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=788444 PT966_RS15525 WP_003152043.1 3131326..3131466(-) (degQ) [Bacillus velezensis strain ZY1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891