Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PO845_RS14955 Genome accession   NZ_CP117857
Coordinates   3073657..3073797 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain PT4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3068657..3078797
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO845_RS14930 (PO845_14930) - 3068971..3069354 (-) 384 WP_061860832.1 hotdog fold thioesterase -
  PO845_RS14935 (PO845_14935) comA 3069376..3070020 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  PO845_RS14940 (PO845_14940) comP 3070101..3072452 (-) 2352 WP_015418104.1 histidine kinase Regulator
  PO845_RS14945 (PO845_14945) comX 3072430..3072600 (-) 171 WP_015418105.1 competence pheromone ComX -
  PO845_RS14950 (PO845_14950) - 3072597..3073526 (-) 930 WP_224462816.1 polyprenyl synthetase family protein -
  PO845_RS14955 (PO845_14955) degQ 3073657..3073797 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PO845_RS14960 (PO845_14960) - 3074263..3074604 (+) 342 WP_015418107.1 hypothetical protein -
  PO845_RS14965 (PO845_14965) - 3074611..3075834 (-) 1224 WP_015418108.1 EAL and HDOD domain-containing protein -
  PO845_RS14970 (PO845_14970) - 3075964..3077430 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  PO845_RS14975 (PO845_14975) - 3077448..3077999 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  PO845_RS14980 (PO845_14980) - 3078096..3078495 (-) 400 Protein_2876 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=788063 PO845_RS14955 WP_003152043.1 3073657..3073797(-) (degQ) [Bacillus velezensis strain PT4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=788063 PO845_RS14955 WP_003152043.1 3073657..3073797(-) (degQ) [Bacillus velezensis strain PT4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891