Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | PO845_RS14955 | Genome accession | NZ_CP117857 |
| Coordinates | 3073657..3073797 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis strain PT4 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3068657..3078797
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PO845_RS14930 (PO845_14930) | - | 3068971..3069354 (-) | 384 | WP_061860832.1 | hotdog fold thioesterase | - |
| PO845_RS14935 (PO845_14935) | comA | 3069376..3070020 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| PO845_RS14940 (PO845_14940) | comP | 3070101..3072452 (-) | 2352 | WP_015418104.1 | histidine kinase | Regulator |
| PO845_RS14945 (PO845_14945) | comX | 3072430..3072600 (-) | 171 | WP_015418105.1 | competence pheromone ComX | - |
| PO845_RS14950 (PO845_14950) | - | 3072597..3073526 (-) | 930 | WP_224462816.1 | polyprenyl synthetase family protein | - |
| PO845_RS14955 (PO845_14955) | degQ | 3073657..3073797 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| PO845_RS14960 (PO845_14960) | - | 3074263..3074604 (+) | 342 | WP_015418107.1 | hypothetical protein | - |
| PO845_RS14965 (PO845_14965) | - | 3074611..3075834 (-) | 1224 | WP_015418108.1 | EAL and HDOD domain-containing protein | - |
| PO845_RS14970 (PO845_14970) | - | 3075964..3077430 (-) | 1467 | WP_015418109.1 | nicotinate phosphoribosyltransferase | - |
| PO845_RS14975 (PO845_14975) | - | 3077448..3077999 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| PO845_RS14980 (PO845_14980) | - | 3078096..3078495 (-) | 400 | Protein_2876 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=788063 PO845_RS14955 WP_003152043.1 3073657..3073797(-) (degQ) [Bacillus velezensis strain PT4]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=788063 PO845_RS14955 WP_003152043.1 3073657..3073797(-) (degQ) [Bacillus velezensis strain PT4]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |