Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   Q4I20_RS13350 Genome accession   NZ_CP130597
Coordinates   2552482..2552655 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain NCIB_3610     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2547482..2557655
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q4I20_RS13335 (Q4I20_13330) gcvT 2548281..2549369 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  Q4I20_RS13340 (Q4I20_13335) hepAA 2549811..2551484 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  Q4I20_RS13345 (Q4I20_13340) yqhG 2551505..2552299 (+) 795 WP_003230200.1 YqhG family protein -
  Q4I20_RS13350 (Q4I20_13345) sinI 2552482..2552655 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  Q4I20_RS13355 (Q4I20_13350) sinR 2552689..2553024 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  Q4I20_RS13360 (Q4I20_13355) tasA 2553117..2553902 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  Q4I20_RS13365 (Q4I20_13360) sipW 2553966..2554538 (-) 573 WP_003246088.1 signal peptidase I SipW -
  Q4I20_RS13370 (Q4I20_13365) tapA 2554522..2555283 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  Q4I20_RS13375 (Q4I20_13370) yqzG 2555555..2555881 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  Q4I20_RS13380 (Q4I20_13375) spoIITA 2555923..2556102 (-) 180 WP_003230176.1 YqzE family protein -
  Q4I20_RS13385 (Q4I20_13380) comGG 2556173..2556547 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  Q4I20_RS13390 (Q4I20_13385) comGF 2556548..2556931 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  Q4I20_RS13395 (Q4I20_13390) comGE 2556957..2557304 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=785884 Q4I20_RS13350 WP_003230187.1 2552482..2552655(+) (sinI) [Bacillus subtilis strain NCIB_3610]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=785884 Q4I20_RS13350 WP_003230187.1 2552482..2552655(+) (sinI) [Bacillus subtilis strain NCIB_3610]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1