Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   PO767_RS12985 Genome accession   NZ_CP117182
Coordinates   2621797..2622234 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain Lwp6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2616797..2627234
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO767_RS12935 sinI 2617180..2617353 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PO767_RS12940 sinR 2617387..2617722 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO767_RS12945 - 2617770..2618555 (-) 786 WP_007408329.1 TasA family protein -
  PO767_RS12950 - 2618620..2619204 (-) 585 WP_022552967.1 signal peptidase I -
  PO767_RS12955 tapA 2619176..2619847 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PO767_RS12960 - 2620106..2620435 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PO767_RS12965 - 2620476..2620655 (-) 180 WP_022552966.1 YqzE family protein -
  PO767_RS12970 comGG 2620712..2621089 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO767_RS12975 comGF 2621090..2621485 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PO767_RS12980 comGE 2621499..2621813 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  PO767_RS12985 comGD 2621797..2622234 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  PO767_RS12990 comGC 2622224..2622532 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  PO767_RS12995 comGB 2622537..2623574 (-) 1038 WP_022552962.1 competence type IV pilus assembly protein ComGB Machinery gene
  PO767_RS13000 comGA 2623561..2624631 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  PO767_RS13005 - 2624824..2625774 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  PO767_RS13010 - 2625920..2627221 (+) 1302 WP_022552961.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=782609 PO767_RS12985 WP_007612572.1 2621797..2622234(-) (comGD) [Bacillus velezensis strain Lwp6]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=782609 PO767_RS12985 WP_007612572.1 2621797..2622234(-) (comGD) [Bacillus velezensis strain Lwp6]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTACTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATAACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559