Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PO767_RS12935 Genome accession   NZ_CP117182
Coordinates   2617180..2617353 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain Lwp6     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2612180..2622353
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PO767_RS12920 gcvT 2612993..2614093 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  PO767_RS12925 - 2614517..2616187 (+) 1671 WP_038461530.1 SNF2-related protein -
  PO767_RS12930 - 2616209..2617003 (+) 795 WP_014418368.1 YqhG family protein -
  PO767_RS12935 sinI 2617180..2617353 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  PO767_RS12940 sinR 2617387..2617722 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  PO767_RS12945 - 2617770..2618555 (-) 786 WP_007408329.1 TasA family protein -
  PO767_RS12950 - 2618620..2619204 (-) 585 WP_022552967.1 signal peptidase I -
  PO767_RS12955 tapA 2619176..2619847 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  PO767_RS12960 - 2620106..2620435 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  PO767_RS12965 - 2620476..2620655 (-) 180 WP_022552966.1 YqzE family protein -
  PO767_RS12970 comGG 2620712..2621089 (-) 378 WP_022552965.1 competence type IV pilus minor pilin ComGG Machinery gene
  PO767_RS12975 comGF 2621090..2621485 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  PO767_RS12980 comGE 2621499..2621813 (-) 315 WP_021494312.1 competence type IV pilus minor pilin ComGE Machinery gene
  PO767_RS12985 comGD 2621797..2622234 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=782605 PO767_RS12935 WP_014418369.1 2617180..2617353(+) (sinI) [Bacillus velezensis strain Lwp6]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=782605 PO767_RS12935 WP_014418369.1 2617180..2617353(+) (sinI) [Bacillus velezensis strain Lwp6]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719