Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | Q3B96_RS13315 | Genome accession | NZ_CP130465 |
| Coordinates | 2596835..2596975 (-) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | A0ABM6LMF9 |
| Organism | Bacillus licheniformis strain MGMM9 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2591835..2601975
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q3B96_RS13290 (Q3B96_13290) | - | 2592132..2592521 (-) | 390 | WP_003184847.1 | hotdog fold thioesterase | - |
| Q3B96_RS13295 (Q3B96_13295) | comA | 2592538..2593176 (-) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| Q3B96_RS13300 (Q3B96_13300) | comP | 2593263..2595569 (-) | 2307 | WP_003184851.1 | ATP-binding protein | Regulator |
| Q3B96_RS13305 (Q3B96_13305) | comX | 2595592..2595756 (-) | 165 | WP_003184853.1 | competence pheromone ComX | - |
| Q3B96_RS13310 (Q3B96_13310) | comQ | 2595765..2596646 (-) | 882 | WP_021837675.1 | polyprenyl synthetase family protein | Regulator |
| Q3B96_RS13315 (Q3B96_13315) | degQ | 2596835..2596975 (-) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| Q3B96_RS13320 (Q3B96_13320) | - | 2597461..2597808 (+) | 348 | WP_231105863.1 | SDR family oxidoreductase | - |
| Q3B96_RS13325 (Q3B96_13325) | - | 2597851..2599071 (-) | 1221 | WP_003184864.1 | EAL and HDOD domain-containing protein | - |
| Q3B96_RS13330 (Q3B96_13330) | - | 2599250..2600659 (-) | 1410 | WP_228767691.1 | nicotinate phosphoribosyltransferase | - |
| Q3B96_RS13335 (Q3B96_13335) | - | 2600737..2601288 (-) | 552 | WP_003184868.1 | cysteine hydrolase family protein | - |
| Q3B96_RS13340 (Q3B96_13340) | - | 2601473..2601874 (-) | 402 | WP_003184870.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=782163 Q3B96_RS13315 WP_003184860.1 2596835..2596975(-) (degQ) [Bacillus licheniformis strain MGMM9]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=782163 Q3B96_RS13315 WP_003184860.1 2596835..2596975(-) (degQ) [Bacillus licheniformis strain MGMM9]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTAGAGAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |