Detailed information NTG0782162

Bioinformatically predicted

Overview

• Name: pilJ
• Type: Machinery gene
• Locus tag: PPW95_RS00035
• Genome accession: NZ_CP117038
• Coordinates: 6090..6200 (+)
• Length: 36 a.a.
• NCBI ID: WP_269467447.1
• Uniprot ID: -
• Organism: Vibrio parahaemolyticus strain VP220218
• Function: type IV pilus biogenesis and function (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1090..11200

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PPW95_RS00010 (PPW95_00010)	-	1232..1567 (+)	336	WP_031855794.1	hypothetical protein	-
PPW95_RS00015 (PPW95_00015)	-	1623..2870 (+)	1248	WP_031855795.1	OmpP1/FadL family transporter	-
PPW95_RS00020 (PPW95_00020)	-	2926..4080 (+)	1155	WP_085576882.1	methyl-accepting chemotaxis protein	-
PPW95_RS00025 (PPW95_00025)	tnpA	4262..4684 (+)	423	WP_031855796.1	IS200/IS605 family transposase	-
PPW95_RS00030 (PPW95_00030)	-	4927..5766 (+)	840	WP_085576863.1	hypothetical protein	-
PPW95_RS00035 (PPW95_00035)	pilJ	6090..6200 (+)	111	WP_269467447.1	methyl-accepting chemotaxis protein	Machinery gene
PPW95_RS00040 (PPW95_00040)	-	6645..8210 (+)	1566	WP_050505239.1	EAL domain-containing protein	-

Sequence

Protein

• Length: 36 a.a.
• Molecular weight: 3978.59 Da
• Isoelectric Point: 4.2645

>NTDB_id=782162 PPW95_RS00035 WP_269467447.1 6090..6200(+) (pilJ) [Vibrio parahaemolyticus strain VP220218]
MRIYSDEISTVLDMIESISEQTNLLALNAAIKAPRA

Nucleotide

• Length: 111 bp

>NTDB_id=782162 PPW95_RS00035 WP_269467447.1 6090..6200(+) (pilJ) [Vibrio parahaemolyticus strain VP220218]
TTGAGGATTTATTCGGATGAAATAAGTACTGTTTTAGATATGATTGAATCGATATCTGAACAGACGAATTTGTTAGCGTT
AAATGCAGCAATTAAAGCTCCAAGAGCGTGA

Domains

Predicted by InterproScan.

• Methyl-accepting chemotaxis protein (MCP) signalling domain (MCPsignal) (5-36)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilJ	Synechocystis sp. PCC 6803	56.25	88.889	0.5