Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   PPM34_RS14910 Genome accession   NZ_CP116869
Coordinates   2893490..2893657 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis subsp. subtilis strain MGP001     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 2888490..2898657
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM34_RS14880 mrpE 2888885..2889361 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  PPM34_RS14885 mrpF 2889361..2889645 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  PPM34_RS14890 mnhG 2889629..2890003 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  PPM34_RS14895 yuxO 2890042..2890422 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  PPM34_RS14900 comA 2890441..2891085 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PPM34_RS14905 comP 2891166..2893475 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  PPM34_RS14910 comX 2893490..2893657 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  PPM34_RS14915 comQ 2893645..2894544 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  PPM34_RS14920 degQ 2894729..2894869 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PPM34_RS14925 - 2895091..2895216 (+) 126 WP_003228793.1 hypothetical protein -
  PPM34_RS14930 - 2895330..2895698 (+) 369 WP_003243784.1 hypothetical protein -
  PPM34_RS14935 pdeH 2895674..2896903 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PPM34_RS14940 pncB 2897040..2898512 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=780654 PPM34_RS14910 WP_003242801.1 2893490..2893657(-) (comX) [Bacillus subtilis subsp. subtilis strain MGP001]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=780654 PPM34_RS14910 WP_003242801.1 2893490..2893657(-) (comX) [Bacillus subtilis subsp. subtilis strain MGP001]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1