Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PPM34_RS11400 Genome accession   NZ_CP116869
Coordinates   2239239..2239622 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain MGP001     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2234239..2244622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM34_RS11360 sinI 2235173..2235346 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM34_RS11365 sinR 2235380..2235715 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM34_RS11370 tasA 2235808..2236593 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM34_RS11375 sipW 2236657..2237229 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM34_RS11380 tapA 2237213..2237974 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM34_RS11385 yqzG 2238246..2238572 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM34_RS11390 spoIITA 2238614..2238793 (-) 180 WP_003230176.1 YqzE family protein -
  PPM34_RS11395 comGG 2238864..2239238 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM34_RS11400 comGF 2239239..2239622 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM34_RS11405 comGE 2239648..2239995 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  PPM34_RS11410 comGD 2239979..2240410 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  PPM34_RS11415 comGC 2240400..2240696 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PPM34_RS11420 comGB 2240710..2241747 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  PPM34_RS11425 comGA 2241734..2242804 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PPM34_RS11430 corA 2243216..2244169 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=780633 PPM34_RS11400 WP_003230168.1 2239239..2239622(-) (comGF) [Bacillus subtilis subsp. subtilis strain MGP001]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=780633 PPM34_RS11400 WP_003230168.1 2239239..2239622(-) (comGF) [Bacillus subtilis subsp. subtilis strain MGP001]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1