Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   PPM34_RS11360 Genome accession   NZ_CP116869
Coordinates   2235173..2235346 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain MGP001     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2230173..2240346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM34_RS11345 gcvT 2230972..2232060 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  PPM34_RS11350 hepAA 2232502..2234175 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  PPM34_RS11355 yqhG 2234196..2234990 (+) 795 WP_003230200.1 YqhG family protein -
  PPM34_RS11360 sinI 2235173..2235346 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM34_RS11365 sinR 2235380..2235715 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM34_RS11370 tasA 2235808..2236593 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM34_RS11375 sipW 2236657..2237229 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM34_RS11380 tapA 2237213..2237974 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM34_RS11385 yqzG 2238246..2238572 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM34_RS11390 spoIITA 2238614..2238793 (-) 180 WP_003230176.1 YqzE family protein -
  PPM34_RS11395 comGG 2238864..2239238 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM34_RS11400 comGF 2239239..2239622 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM34_RS11405 comGE 2239648..2239995 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=780630 PPM34_RS11360 WP_003230187.1 2235173..2235346(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP001]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=780630 PPM34_RS11360 WP_003230187.1 2235173..2235346(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP001]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1