Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   PPM30_RS11230 Genome accession   NZ_CP116868
Coordinates   2150696..2151079 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain MGP003     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2145696..2156079
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PPM30_RS11190 sinI 2146630..2146803 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  PPM30_RS11195 sinR 2146837..2147172 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  PPM30_RS11200 tasA 2147265..2148050 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  PPM30_RS11205 sipW 2148114..2148686 (-) 573 WP_003246088.1 signal peptidase I SipW -
  PPM30_RS11210 tapA 2148670..2149431 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  PPM30_RS11215 yqzG 2149703..2150029 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  PPM30_RS11220 spoIITA 2150071..2150250 (-) 180 WP_003230176.1 YqzE family protein -
  PPM30_RS11225 comGG 2150321..2150695 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  PPM30_RS11230 comGF 2150696..2151079 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  PPM30_RS11235 comGE 2151105..2151452 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  PPM30_RS11240 comGD 2151436..2151867 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  PPM30_RS11245 comGC 2151857..2152153 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  PPM30_RS11250 comGB 2152167..2153204 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  PPM30_RS11255 comGA 2153191..2154261 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  PPM30_RS11260 corA 2154673..2155626 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=780549 PPM30_RS11230 WP_003230168.1 2150696..2151079(-) (comGF) [Bacillus subtilis subsp. subtilis strain MGP003]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=780549 PPM30_RS11230 WP_003230168.1 2150696..2151079(-) (comGF) [Bacillus subtilis subsp. subtilis strain MGP003]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1