Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | PPM30_RS11190 | Genome accession | NZ_CP116868 |
| Coordinates | 2146630..2146803 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain MGP003 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2141630..2151803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPM30_RS11175 | gcvT | 2142429..2143517 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| PPM30_RS11180 | hepAA | 2143959..2145632 (+) | 1674 | WP_004398544.1 | DEAD/DEAH box helicase | - |
| PPM30_RS11185 | yqhG | 2145653..2146447 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| PPM30_RS11190 | sinI | 2146630..2146803 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| PPM30_RS11195 | sinR | 2146837..2147172 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| PPM30_RS11200 | tasA | 2147265..2148050 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| PPM30_RS11205 | sipW | 2148114..2148686 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| PPM30_RS11210 | tapA | 2148670..2149431 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| PPM30_RS11215 | yqzG | 2149703..2150029 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| PPM30_RS11220 | spoIITA | 2150071..2150250 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| PPM30_RS11225 | comGG | 2150321..2150695 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| PPM30_RS11230 | comGF | 2150696..2151079 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| PPM30_RS11235 | comGE | 2151105..2151452 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=780546 PPM30_RS11190 WP_003230187.1 2146630..2146803(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP003]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=780546 PPM30_RS11190 WP_003230187.1 2146630..2146803(+) (sinI) [Bacillus subtilis subsp. subtilis strain MGP003]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |