Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PNF29_RS05105 Genome accession   NZ_CP116773
Coordinates   995300..995440 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM125727     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 990300..1000440
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PNF29_RS05075 (PNF29_05075) yueI 990594..990992 (+) 399 WP_017695530.1 YueI family protein -
  PNF29_RS05080 (PNF29_05080) pncA 991089..991640 (+) 552 WP_014480709.1 cysteine hydrolase family protein -
  PNF29_RS05085 (PNF29_05085) pncB 991656..993128 (+) 1473 WP_041352162.1 nicotinate phosphoribosyltransferase -
  PNF29_RS05090 (PNF29_05090) pdeH 993265..994494 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PNF29_RS05095 (PNF29_05095) - 994470..994838 (-) 369 WP_017695529.1 hypothetical protein -
  PNF29_RS05100 (PNF29_05100) - 995016..995078 (-) 63 Protein_1016 hypothetical protein -
  PNF29_RS05105 (PNF29_05105) degQ 995300..995440 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PNF29_RS05110 (PNF29_05110) - 995625..996494 (+) 870 WP_095843911.1 polyprenyl synthetase family protein -
  PNF29_RS05115 (PNF29_05115) comX 996491..996712 (+) 222 WP_014114983.1 competence pheromone ComX -
  PNF29_RS05120 (PNF29_05120) comP 996728..999040 (+) 2313 WP_099085219.1 histidine kinase Regulator
  PNF29_RS05125 (PNF29_05125) comA 999121..999765 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PNF29_RS05130 (PNF29_05130) yuxO 999784..1000164 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=780088 PNF29_RS05105 WP_003220708.1 995300..995440(+) (degQ) [Bacillus subtilis strain SRCM125727]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=780088 PNF29_RS05105 WP_003220708.1 995300..995440(+) (degQ) [Bacillus subtilis strain SRCM125727]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1