Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PIB33_RS17430 Genome accession   NZ_CP116391
Coordinates   3271963..3272103 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain GXD-20     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3266963..3277103
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PIB33_RS17405 (PIB33_17405) yuxO 3267240..3267620 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  PIB33_RS17410 (PIB33_17410) comA 3267639..3268283 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  PIB33_RS17415 (PIB33_17415) comP 3268364..3270676 (-) 2313 WP_304988957.1 histidine kinase Regulator
  PIB33_RS17420 (PIB33_17420) comX 3270692..3270913 (-) 222 WP_014480704.1 competence pheromone ComX -
  PIB33_RS17425 (PIB33_17425) - 3270915..3271778 (-) 864 WP_032722437.1 polyprenyl synthetase family protein -
  PIB33_RS17430 (PIB33_17430) degQ 3271963..3272103 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  PIB33_RS17435 (PIB33_17435) - 3272325..3272450 (+) 126 WP_003228793.1 hypothetical protein -
  PIB33_RS17440 (PIB33_17440) - 3272564..3272932 (+) 369 WP_014477834.1 hypothetical protein -
  PIB33_RS17445 (PIB33_17445) pdeH 3272908..3274137 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  PIB33_RS17450 (PIB33_17450) pncB 3274274..3275746 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  PIB33_RS17455 (PIB33_17455) pncA 3275762..3276313 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  PIB33_RS17460 (PIB33_17460) yueI 3276410..3276808 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=777045 PIB33_RS17430 WP_003220708.1 3271963..3272103(-) (degQ) [Bacillus subtilis strain GXD-20]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=777045 PIB33_RS17430 WP_003220708.1 3271963..3272103(-) (degQ) [Bacillus subtilis strain GXD-20]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1