Detailed information
Bioinformatically predicted
Overview
| Name | pilK | Type | Machinery gene |
| Locus tag | PH604_RS02310 | Genome accession | NZ_CP116342 |
| Coordinates | 449552..450163 (+) | Length | 203 a.a. |
| NCBI ID | WP_012503481.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain SE690. | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 445622..501827 | 449552..450163 | within | 0 |
Gene organization within MGE regions
Location: 445622..501827
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH604_RS02290 (PH604_02280) | dnaB | 445622..447028 (+) | 1407 | WP_272656700.1 | replicative DNA helicase | - |
| PH604_RS02295 (PH604_02285) | pilH | 447336..448001 (+) | 666 | WP_047918678.1 | GspH/FimT family pseudopilin | Machinery gene |
| PH604_RS02300 (PH604_02290) | pilV | 448033..448644 (+) | 612 | WP_050164991.1 | type IV pilus modification protein PilV | Machinery gene |
| PH604_RS02305 (PH604_02295) | pilJ | 448641..449573 (+) | 933 | WP_050164989.1 | PilW family protein | Machinery gene |
| PH604_RS02310 (PH604_02300) | pilK | 449552..450163 (+) | 612 | WP_012503481.1 | pilus assembly PilX family protein | Machinery gene |
| PH604_RS02315 (PH604_02305) | pilL | 450165..450638 (+) | 474 | WP_263315253.1 | PilX family type IV pilin | Machinery gene |
| PH604_RS02320 (PH604_02310) | - | 450708..451016 (-) | 309 | WP_025456241.1 | AzlD family protein | - |
| PH604_RS02325 (PH604_02315) | - | 451013..451722 (-) | 710 | Protein_456 | AzlC family ABC transporter permease | - |
| PH604_RS02330 (PH604_02320) | dut | 451888..452340 (+) | 453 | WP_003687923.1 | dUTP diphosphatase | - |
| PH604_RS02335 (PH604_02325) | dapC | 452418..453605 (+) | 1188 | WP_196427628.1 | succinyldiaminopimelate transaminase | - |
| PH604_RS02340 (PH604_02330) | yaaA | 453761..454540 (+) | 780 | WP_272656701.1 | peroxide stress protein YaaA | - |
| PH604_RS02355 (PH604_02345) | - | 455071..456265 (+) | 1195 | Protein_460 | tyrosine-type recombinase/integrase | - |
| PH604_RS02360 (PH604_02350) | - | 456621..456890 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| PH604_RS02365 (PH604_02355) | - | 457085..457768 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| PH604_RS11740 | - | 458049..458315 (-) | 267 | Protein_463 | hypothetical protein | - |
| PH604_RS02375 (PH604_02365) | - | 458426..458641 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| PH604_RS02380 (PH604_02370) | - | 458693..459184 (-) | 492 | WP_017147227.1 | siphovirus Gp157 family protein | - |
| PH604_RS02385 (PH604_02375) | - | 459181..459363 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| PH604_RS02390 (PH604_02380) | - | 459503..460189 (-) | 687 | WP_272656702.1 | phage replication initiation protein, NGO0469 family | - |
| PH604_RS02395 (PH604_02385) | - | 460258..460419 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| PH604_RS02400 (PH604_02390) | - | 460416..460694 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| PH604_RS02405 (PH604_02395) | - | 460847..461179 (-) | 333 | WP_003691528.1 | hypothetical protein | - |
| PH604_RS02410 (PH604_02400) | - | 461320..461595 (-) | 276 | WP_192212651.1 | hypothetical protein | - |
| PH604_RS02415 (PH604_02405) | - | 461592..462068 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| PH604_RS02420 (PH604_02410) | - | 462101..462301 (-) | 201 | WP_048654497.1 | hypothetical protein | - |
| PH604_RS02425 (PH604_02415) | - | 462499..462912 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| PH604_RS02430 (PH604_02420) | - | 462909..463370 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS02435 (PH604_02425) | - | 463387..463824 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| PH604_RS02440 (PH604_02430) | - | 463937..464653 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| PH604_RS02445 (PH604_02435) | - | 464728..464958 (+) | 231 | WP_020997318.1 | transcriptional regulator | - |
| PH604_RS02450 (PH604_02440) | - | 465038..465193 (+) | 156 | WP_003689578.1 | hypothetical protein | - |
| PH604_RS02455 (PH604_02445) | - | 465170..465358 (-) | 189 | WP_050157615.1 | hypothetical protein | - |
| PH604_RS02460 (PH604_02450) | - | 465531..465758 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS02465 (PH604_02455) | - | 465755..466750 (+) | 996 | WP_272656703.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS02470 (PH604_02460) | - | 466764..467546 (+) | 783 | WP_025456432.1 | ATP-binding protein | - |
| PH604_RS02475 (PH604_02465) | - | 467559..467822 (+) | 264 | WP_272656704.1 | hypothetical protein | - |
| PH604_RS02480 (PH604_02470) | - | 467861..468355 (+) | 495 | WP_047923242.1 | DUF3310 domain-containing protein | - |
| PH604_RS02485 (PH604_02475) | - | 468532..468681 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| PH604_RS02490 (PH604_02480) | - | 468710..468991 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| PH604_RS02495 (PH604_02485) | - | 468982..469362 (+) | 381 | WP_082295559.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PH604_RS02500 (PH604_02495) | - | 469629..470036 (+) | 408 | WP_123768252.1 | hypothetical protein | - |
| PH604_RS02505 (PH604_02500) | - | 470097..471056 (+) | 960 | WP_123768253.1 | hypothetical protein | - |
| PH604_RS02510 (PH604_02505) | - | 471551..472438 (+) | 888 | WP_272656705.1 | KilA-N domain-containing protein | - |
| PH604_RS02515 (PH604_02510) | - | 472731..473180 (+) | 450 | WP_003689093.1 | hypothetical protein | - |
| PH604_RS02520 (PH604_02515) | terL | 473242..474663 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| PH604_RS02525 (PH604_02520) | - | 474660..476807 (+) | 2148 | WP_064662124.1 | phage portal protein | - |
| PH604_RS02530 (PH604_02525) | - | 476875..478032 (+) | 1158 | WP_010360058.1 | HK97 family phage prohead protease | - |
| PH604_RS02535 (PH604_02530) | - | 478074..479573 (+) | 1500 | WP_272656706.1 | hypothetical protein | - |
| PH604_RS02540 (PH604_02535) | - | 479580..479936 (+) | 357 | WP_003691418.1 | hypothetical protein | - |
| PH604_RS02545 (PH604_02540) | - | 479939..480469 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| PH604_RS02550 (PH604_02545) | - | 480469..480951 (+) | 483 | WP_048339669.1 | HK97 gp10 family phage protein | - |
| PH604_RS02555 (PH604_02550) | - | 480948..481376 (+) | 429 | WP_003689076.1 | hypothetical protein | - |
| PH604_RS02560 (PH604_02555) | - | 481402..482175 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| PH604_RS02565 (PH604_02560) | - | 482236..482565 (+) | 330 | WP_003692871.1 | hypothetical protein | - |
| PH604_RS02570 (PH604_02565) | - | 482577..482843 (+) | 267 | WP_003689070.1 | hypothetical protein | - |
| PH604_RS02575 (PH604_02570) | - | 482843..483442 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| PH604_RS02580 (PH604_02575) | - | 483439..484293 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| PH604_RS02585 (PH604_02580) | - | 484295..484726 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| PH604_RS02590 (PH604_02585) | - | 484754..485032 (-) | 279 | WP_003692877.1 | helix-turn-helix domain-containing protein | - |
| PH604_RS02595 (PH604_02590) | - | 485272..489417 (+) | 4146 | WP_272656707.1 | phage tail protein | - |
| PH604_RS02600 (PH604_02595) | - | 489529..489834 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| PH604_RS02605 (PH604_02600) | - | 489905..490375 (+) | 471 | WP_003691410.1 | hypothetical protein | - |
| PH604_RS02610 (PH604_02605) | - | 490376..490708 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| PH604_RS02615 (PH604_02610) | - | 491076..491423 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| PH604_RS02620 (PH604_02615) | - | 491423..491659 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| PH604_RS02625 (PH604_02625) | - | 491866..492405 (+) | 540 | WP_050163081.1 | TIGR02594 family protein | - |
| PH604_RS02630 (PH604_02630) | - | 492405..492563 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| PH604_RS02635 (PH604_02635) | - | 492547..492888 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| PH604_RS02640 (PH604_02640) | - | 492872..493045 (+) | 174 | WP_017146757.1 | hypothetical protein | - |
| PH604_RS02645 (PH604_02645) | - | 493357..493506 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| PH604_RS02650 (PH604_02650) | - | 493536..496580 (+) | 3045 | WP_272656709.1 | tape measure protein | - |
| PH604_RS02655 (PH604_02655) | - | 496640..497119 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| PH604_RS02660 (PH604_02660) | - | 497461..498450 (-) | 990 | WP_003689040.1 | tyrosine-type recombinase/integrase | - |
| PH604_RS02665 (PH604_02665) | - | 498710..498898 (-) | 189 | WP_003689039.1 | hypothetical protein | - |
| PH604_RS02670 (PH604_02670) | purM | 499139..500173 (+) | 1035 | WP_003698590.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| PH604_RS02675 (PH604_02675) | - | 500791..501096 (+) | 306 | WP_082294427.1 | hypothetical protein | - |
| PH604_RS02680 (PH604_02680) | - | 501174..501827 (+) | 654 | WP_272656711.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 203 a.a. Molecular weight: 22021.91 Da Isoelectric Point: 8.0862
>NTDB_id=776752 PH604_RS02310 WP_012503481.1 449552..450163(+) (pilK) [Neisseria gonorrhoeae strain SE690.]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYAA
DSKVTFSENCEKGLCTAVNVRTNDNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTGNVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ
Nucleotide
Download Length: 612 bp
>NTDB_id=776752 PH604_RS02310 WP_012503481.1 449552..450163(+) (pilK) [Neisseria gonorrhoeae strain SE690.]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGCGGGAGGGCGAATTTCAGGTTTTGGATTTGGAATATGCTGCG
GACAGTAAGGTTACGTTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATGATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilK | Neisseria gonorrhoeae MS11 |
96.059 |
100 |
0.961 |