Detailed information
Bioinformatically predicted
Overview
| Name | pilD | Type | Machinery gene |
| Locus tag | PHA56_RS23350 | Genome accession | NZ_CP116214 |
| Coordinates | 4927325..4928122 (+) | Length | 265 a.a. |
| NCBI ID | WP_032694399.1 | Uniprot ID | A0A2J5PD60 |
| Organism | Klebsiella michiganensis strain 2563 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 4882789..4931258 | 4927325..4928122 | within | 0 |
Gene organization within MGE regions
Location: 4882789..4931258
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS23050 (PHA56_23050) | gspC | 4882789..4883625 (+) | 837 | WP_076752491.1 | type II secretion system protein GspC | - |
| PHA56_RS23055 (PHA56_23055) | pulD | 4883662..4885608 (+) | 1947 | WP_029946937.1 | GspD family T2SS secretin variant PulD | - |
| PHA56_RS23060 (PHA56_23060) | gspE | 4885605..4887098 (+) | 1494 | WP_025107369.1 | type II secretion system ATPase GspE | - |
| PHA56_RS23065 (PHA56_23065) | gspF | 4887100..4888305 (+) | 1206 | WP_038424081.1 | type II secretion system inner membrane protein GspF | - |
| PHA56_RS23070 (PHA56_23070) | gspG | 4888326..4888748 (+) | 423 | WP_004098709.1 | type II secretion system major pseudopilin GspG | - |
| PHA56_RS23075 (PHA56_23075) | gspH | 4888748..4889260 (+) | 513 | WP_038424080.1 | type II secretion system minor pseudopilin GspH | - |
| PHA56_RS23080 (PHA56_23080) | gspI | 4889257..4889622 (+) | 366 | WP_009654631.1 | type II secretion system minor pseudopilin GspI | - |
| PHA56_RS23085 (PHA56_23085) | gspJ | 4889619..4890215 (+) | 597 | WP_014837428.1 | type II secretion system minor pseudopilin GspJ | - |
| PHA56_RS23090 (PHA56_23090) | - | 4890212..4890349 (+) | 138 | Protein_4551 | type II secretion system minor pseudopilin GspK | - |
| PHA56_RS23095 (PHA56_23095) | - | 4890599..4891237 (-) | 639 | WP_032751450.1 | helix-turn-helix domain-containing protein | - |
| PHA56_RS23100 (PHA56_23100) | - | 4891409..4891633 (+) | 225 | WP_032751971.1 | helix-turn-helix domain-containing protein | - |
| PHA56_RS23105 (PHA56_23105) | - | 4891636..4893714 (+) | 2079 | WP_032751449.1 | Mu transposase C-terminal domain-containing protein | - |
| PHA56_RS23110 (PHA56_23110) | - | 4893750..4894697 (+) | 948 | WP_032751448.1 | AAA family ATPase | - |
| PHA56_RS23115 (PHA56_23115) | - | 4894703..4895038 (+) | 336 | WP_032751446.1 | hypothetical protein | - |
| PHA56_RS23120 (PHA56_23120) | - | 4895016..4895255 (+) | 240 | WP_032751445.1 | hypothetical protein | - |
| PHA56_RS23125 (PHA56_23125) | - | 4895258..4895545 (+) | 288 | WP_004114541.1 | HTH domain-containing protein | - |
| PHA56_RS23130 (PHA56_23130) | - | 4895561..4896178 (+) | 618 | WP_032751444.1 | DUF3164 family protein | - |
| PHA56_RS23135 (PHA56_23135) | - | 4896259..4896753 (+) | 495 | WP_032751970.1 | hypothetical protein | - |
| PHA56_RS23140 (PHA56_23140) | - | 4896746..4897045 (+) | 300 | WP_032751443.1 | hypothetical protein | - |
| PHA56_RS23145 (PHA56_23145) | - | 4897042..4897266 (-) | 225 | WP_032751442.1 | hypothetical protein | - |
| PHA56_RS23150 (PHA56_23150) | - | 4897336..4897890 (+) | 555 | WP_032751440.1 | gp16 family protein | - |
| PHA56_RS23155 (PHA56_23155) | - | 4897887..4898282 (+) | 396 | WP_032751439.1 | Mor transcription activator family protein | - |
| PHA56_RS23160 (PHA56_23160) | - | 4898286..4898798 (+) | 513 | WP_032751438.1 | hypothetical protein | - |
| PHA56_RS23165 (PHA56_23165) | - | 4898893..4899471 (+) | 579 | WP_032751436.1 | glycoside hydrolase family 108 protein | - |
| PHA56_RS23170 (PHA56_23170) | - | 4899474..4899692 (+) | 219 | WP_071995746.1 | hypothetical protein | - |
| PHA56_RS23175 (PHA56_23175) | - | 4899685..4900092 (+) | 408 | WP_032751969.1 | hypothetical protein | - |
| PHA56_RS23180 (PHA56_23180) | - | 4900080..4900691 (+) | 612 | WP_032751434.1 | hypothetical protein | - |
| PHA56_RS23185 (PHA56_23185) | - | 4900688..4900918 (+) | 231 | WP_032751432.1 | TraR/DksA family transcriptional regulator | - |
| PHA56_RS23190 (PHA56_23190) | - | 4900899..4901201 (+) | 303 | WP_016807466.1 | DUF2730 domain-containing protein | - |
| PHA56_RS23195 (PHA56_23195) | - | 4901211..4901498 (+) | 288 | WP_004114568.1 | hypothetical protein | - |
| PHA56_RS23200 (PHA56_23200) | - | 4901498..4901785 (+) | 288 | WP_032751429.1 | hypothetical protein | - |
| PHA56_RS23205 (PHA56_23205) | - | 4901775..4902350 (+) | 576 | WP_032751427.1 | DUF3486 family protein | - |
| PHA56_RS23210 (PHA56_23210) | - | 4902347..4903933 (+) | 1587 | WP_032751425.1 | terminase large subunit domain-containing protein | - |
| PHA56_RS23215 (PHA56_23215) | - | 4903933..4905504 (+) | 1572 | WP_032751423.1 | DUF935 domain-containing protein | - |
| PHA56_RS23220 (PHA56_23220) | - | 4905497..4906339 (+) | 843 | WP_032751422.1 | phage minor head protein | - |
| PHA56_RS23225 (PHA56_23225) | - | 4906573..4907544 (+) | 972 | WP_032751420.1 | phage protease | - |
| PHA56_RS23230 (PHA56_23230) | - | 4907547..4908449 (+) | 903 | WP_076752593.1 | Mu-like prophage major head subunit gpT family protein | - |
| PHA56_RS23235 (PHA56_23235) | - | 4908523..4909029 (+) | 507 | WP_032751416.1 | hypothetical protein | - |
| PHA56_RS23240 (PHA56_23240) | - | 4909029..4909469 (+) | 441 | WP_032751414.1 | gp436 family protein | - |
| PHA56_RS23245 (PHA56_23245) | - | 4909469..4910011 (+) | 543 | WP_032751412.1 | phage virion morphogenesis protein | - |
| PHA56_RS23250 (PHA56_23250) | - | 4910008..4910619 (+) | 612 | WP_032751410.1 | hypothetical protein | - |
| PHA56_RS23255 (PHA56_23255) | - | 4910622..4910831 (+) | 210 | WP_032751409.1 | DUF2635 domain-containing protein | - |
| PHA56_RS23260 (PHA56_23260) | - | 4910833..4912314 (+) | 1482 | WP_032751407.1 | phage tail sheath subtilisin-like domain-containing protein | - |
| PHA56_RS23265 (PHA56_23265) | - | 4912324..4912677 (+) | 354 | WP_032751406.1 | phage tail tube protein | - |
| PHA56_RS23270 (PHA56_23270) | - | 4912681..4913064 (+) | 384 | WP_032751403.1 | phage tail assembly protein | - |
| PHA56_RS23275 (PHA56_23275) | - | 4913163..4915016 (+) | 1854 | WP_032751402.1 | phage tail tape measure protein | - |
| PHA56_RS23280 (PHA56_23280) | - | 4915016..4916275 (+) | 1260 | WP_032751401.1 | DNA circularization protein | - |
| PHA56_RS23285 (PHA56_23285) | - | 4916268..4917359 (+) | 1092 | WP_032751400.1 | phage baseplate assembly protein | - |
| PHA56_RS23290 (PHA56_23290) | - | 4917350..4917889 (+) | 540 | WP_032751398.1 | phage baseplate assembly protein V | - |
| PHA56_RS23295 (PHA56_23295) | - | 4917886..4918338 (+) | 453 | WP_016807445.1 | phage GP46 family protein | - |
| PHA56_RS23300 (PHA56_23300) | - | 4918325..4919401 (+) | 1077 | WP_032751397.1 | baseplate J/gp47 family protein | - |
| PHA56_RS23305 (PHA56_23305) | - | 4919386..4919970 (+) | 585 | WP_016807443.1 | YmfQ family protein | - |
| PHA56_RS23310 (PHA56_23310) | - | 4919973..4920785 (+) | 813 | WP_032751396.1 | phage tail protein | - |
| PHA56_RS23315 (PHA56_23315) | - | 4920785..4921660 (+) | 876 | WP_032751395.1 | tail fiber assembly protein | - |
| PHA56_RS23320 (PHA56_23320) | - | 4921670..4923628 (+) | 1959 | WP_050597590.1 | glycosyl hydrolase family 28 protein | - |
| PHA56_RS23325 (PHA56_23325) | - | 4923636..4923884 (+) | 249 | WP_032751394.1 | hypothetical protein | - |
| PHA56_RS23330 (PHA56_23330) | gspK | 4924050..4924910 (+) | 861 | Protein_4599 | type II secretion system minor pseudopilin GspK | - |
| PHA56_RS23335 (PHA56_23335) | gspL | 4924903..4926096 (+) | 1194 | WP_032720564.1 | type II secretion system protein GspL | - |
| PHA56_RS23340 (PHA56_23340) | gspM | 4926089..4926574 (+) | 486 | WP_038424078.1 | type II secretion system protein GspM | - |
| PHA56_RS23345 (PHA56_23345) | - | 4926564..4927322 (+) | 759 | WP_038424077.1 | type II secretion system protein N | - |
| PHA56_RS23350 (PHA56_23350) | pilD | 4927325..4928122 (+) | 798 | WP_032694399.1 | prepilin peptidase | Machinery gene |
| PHA56_RS23355 (PHA56_23355) | hrpB | 4928220..4930649 (-) | 2430 | WP_038424076.1 | ATP-dependent helicase HrpB | - |
| PHA56_RS23360 (PHA56_23360) | thpR | 4930722..4931258 (+) | 537 | WP_014227968.1 | RNA 2',3'-cyclic phosphodiesterase | - |
Sequence
Protein
Download Length: 265 a.a. Molecular weight: 29150.77 Da Isoelectric Point: 8.3410
>NTDB_id=776189 PHA56_RS23350 WP_032694399.1 4927325..4928122(+) (pilD) [Klebsiella michiganensis strain 2563]
MENIALLPEFAAQFPSIWGGFLFLSGLAFGSFFNVVIHRLPLMMERAEGVNLCLPASFCPQCRQPIAWRDNIPLLSFLWL
RGRARCCGQPISRRYPLMELTTGALFVLAGYLMAPGMPLLGGLIFVSVLLILAAIDAQTQLLPDRLTLPLLWAGLLFNLS
DTFAPLAEAVIGAMVGYLSLWSVYWVFRLLTGKEALGYGDFKLLAALGAWLGWQPLPQTLLLASASGLVWTLLQRLVTRR
SLEQPLAFGPWLALAGGGIFLWSQV
MENIALLPEFAAQFPSIWGGFLFLSGLAFGSFFNVVIHRLPLMMERAEGVNLCLPASFCPQCRQPIAWRDNIPLLSFLWL
RGRARCCGQPISRRYPLMELTTGALFVLAGYLMAPGMPLLGGLIFVSVLLILAAIDAQTQLLPDRLTLPLLWAGLLFNLS
DTFAPLAEAVIGAMVGYLSLWSVYWVFRLLTGKEALGYGDFKLLAALGAWLGWQPLPQTLLLASASGLVWTLLQRLVTRR
SLEQPLAFGPWLALAGGGIFLWSQV
Nucleotide
Download Length: 798 bp
>NTDB_id=776189 PHA56_RS23350 WP_032694399.1 4927325..4928122(+) (pilD) [Klebsiella michiganensis strain 2563]
ATGGAAAATATCGCGCTGTTACCCGAGTTCGCCGCGCAATTCCCGTCAATCTGGGGCGGCTTTTTATTCCTGTCCGGACT
GGCGTTCGGCAGCTTTTTTAACGTCGTTATCCATCGTTTACCGCTGATGATGGAACGCGCAGAGGGGGTAAATCTCTGCC
TCCCCGCCTCGTTCTGCCCGCAGTGCCGTCAGCCTATCGCCTGGCGGGACAATATCCCGCTGCTGAGCTTTTTATGGCTC
AGGGGGCGCGCGCGCTGCTGCGGGCAGCCGATCTCGCGTCGCTATCCCCTGATGGAGCTGACGACCGGCGCGCTGTTTGT
ACTCGCGGGGTACCTGATGGCTCCGGGCATGCCGCTGCTGGGCGGGCTAATTTTCGTGTCCGTACTGCTGATCCTCGCCG
CCATCGACGCGCAAACGCAGCTGCTGCCTGACAGGCTGACGCTGCCGCTGCTGTGGGCCGGGCTGCTGTTCAATCTTTCC
GATACCTTCGCGCCGCTGGCGGAGGCGGTCATTGGCGCGATGGTCGGGTATTTGTCGCTGTGGTCGGTGTACTGGGTGTT
CCGTCTGCTGACCGGTAAAGAGGCGCTGGGCTACGGCGATTTCAAGCTGCTGGCAGCGCTCGGCGCGTGGCTCGGCTGGC
AGCCGCTGCCGCAGACGCTGCTGCTGGCTTCCGCCAGCGGTCTGGTCTGGACGCTGCTGCAGCGTCTGGTAACCCGTCGT
TCGCTCGAACAACCTCTGGCCTTCGGCCCCTGGCTGGCGCTGGCGGGCGGCGGCATCTTTTTGTGGAGCCAGGTATAA
ATGGAAAATATCGCGCTGTTACCCGAGTTCGCCGCGCAATTCCCGTCAATCTGGGGCGGCTTTTTATTCCTGTCCGGACT
GGCGTTCGGCAGCTTTTTTAACGTCGTTATCCATCGTTTACCGCTGATGATGGAACGCGCAGAGGGGGTAAATCTCTGCC
TCCCCGCCTCGTTCTGCCCGCAGTGCCGTCAGCCTATCGCCTGGCGGGACAATATCCCGCTGCTGAGCTTTTTATGGCTC
AGGGGGCGCGCGCGCTGCTGCGGGCAGCCGATCTCGCGTCGCTATCCCCTGATGGAGCTGACGACCGGCGCGCTGTTTGT
ACTCGCGGGGTACCTGATGGCTCCGGGCATGCCGCTGCTGGGCGGGCTAATTTTCGTGTCCGTACTGCTGATCCTCGCCG
CCATCGACGCGCAAACGCAGCTGCTGCCTGACAGGCTGACGCTGCCGCTGCTGTGGGCCGGGCTGCTGTTCAATCTTTCC
GATACCTTCGCGCCGCTGGCGGAGGCGGTCATTGGCGCGATGGTCGGGTATTTGTCGCTGTGGTCGGTGTACTGGGTGTT
CCGTCTGCTGACCGGTAAAGAGGCGCTGGGCTACGGCGATTTCAAGCTGCTGGCAGCGCTCGGCGCGTGGCTCGGCTGGC
AGCCGCTGCCGCAGACGCTGCTGCTGGCTTCCGCCAGCGGTCTGGTCTGGACGCTGCTGCAGCGTCTGGTAACCCGTCGT
TCGCTCGAACAACCTCTGGCCTTCGGCCCCTGGCTGGCGCTGGCGGGCGGCGGCATCTTTTTGTGGAGCCAGGTATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilD | Vibrio cholerae strain A1552 |
49.808 |
98.491 |
0.491 |
| pilD | Neisseria gonorrhoeae MS11 |
44.604 |
100 |
0.468 |
| pilD | Vibrio campbellii strain DS40M4 |
43.273 |
100 |
0.449 |
| pilD | Acinetobacter nosocomialis M2 |
44.788 |
97.736 |
0.438 |
| pilD | Acinetobacter baumannii D1279779 |
44.402 |
97.736 |
0.434 |