Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   PF986_RS17505 Genome accession   NZ_CP116013
Coordinates   3545903..3546022 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain SRCM124349     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 3540903..3551022
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF986_RS17490 (PF986_17490) - 3542515..3543198 (+) 684 WP_014416901.1 response regulator transcription factor -
  PF986_RS17495 (PF986_17495) - 3543185..3544612 (+) 1428 WP_088056326.1 sensor histidine kinase -
  PF986_RS17500 (PF986_17500) rapC 3544771..3545919 (+) 1149 WP_014304340.1 Rap family tetratricopeptide repeat protein Regulator
  PF986_RS17505 (PF986_17505) phrC 3545903..3546022 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  PF986_RS17510 (PF986_17510) - 3546173..3546283 (-) 111 WP_369878517.1 YjcZ family sporulation protein -
  PF986_RS17515 (PF986_17515) - 3546363..3547727 (-) 1365 WP_110085395.1 aspartate kinase -
  PF986_RS17520 (PF986_17520) ceuB 3548141..3549094 (+) 954 WP_003156332.1 ABC transporter permease Machinery gene
  PF986_RS17525 (PF986_17525) - 3549084..3550031 (+) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  PF986_RS17530 (PF986_17530) - 3550025..3550783 (+) 759 WP_012116804.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=775223 PF986_RS17505 WP_003156334.1 3545903..3546022(+) (phrC) [Bacillus velezensis strain SRCM124349]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=775223 PF986_RS17505 WP_003156334.1 3545903..3546022(+) (phrC) [Bacillus velezensis strain SRCM124349]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718