Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   PF976_RS12520 Genome accession   NZ_CP116011
Coordinates   2414559..2414873 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain SRCM124317     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2409559..2419873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF976_RS12475 (PF976_12475) sinI 2410243..2410416 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  PF976_RS12480 (PF976_12480) sinR 2410450..2410785 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  PF976_RS12485 (PF976_12485) tasA 2410833..2411618 (-) 786 WP_271229891.1 biofilm matrix protein TasA -
  PF976_RS12490 (PF976_12490) sipW 2411683..2412267 (-) 585 WP_013352863.1 signal peptidase I SipW -
  PF976_RS12495 (PF976_12495) tapA 2412239..2412910 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  PF976_RS12500 (PF976_12500) - 2413168..2413497 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  PF976_RS12505 (PF976_12505) - 2413538..2413717 (-) 180 WP_013352866.1 YqzE family protein -
  PF976_RS12510 (PF976_12510) comGG 2413771..2414148 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  PF976_RS12515 (PF976_12515) comGF 2414150..2414650 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  PF976_RS12520 (PF976_12520) comGE 2414559..2414873 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  PF976_RS12525 (PF976_12525) comGD 2414857..2415294 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  PF976_RS12530 (PF976_12530) comGC 2415284..2415550 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  PF976_RS12535 (PF976_12535) comGB 2415597..2416634 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  PF976_RS12540 (PF976_12540) comGA 2416621..2417691 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  PF976_RS12545 (PF976_12545) - 2417885..2418835 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=775038 PF976_RS12520 WP_014470662.1 2414559..2414873(-) (comGE) [Bacillus amyloliquefaciens strain SRCM124317]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=775038 PF976_RS12520 WP_014470662.1 2414559..2414873(-) (comGE) [Bacillus amyloliquefaciens strain SRCM124317]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481