Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   PF976_RS01745 Genome accession   NZ_CP116011
Coordinates   342631..342750 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens strain SRCM124317     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 337631..347750
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF976_RS01730 (PF976_01730) - 339243..339926 (+) 684 WP_013351002.1 response regulator transcription factor -
  PF976_RS01735 (PF976_01735) - 339913..341340 (+) 1428 WP_161988189.1 sensor histidine kinase -
  PF976_RS01740 (PF976_01740) rapC 341499..342647 (+) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  PF976_RS01745 (PF976_01745) phrC 342631..342750 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  PF976_RS01750 (PF976_01750) - 342898..342999 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  PF976_RS01755 (PF976_01755) - 343094..344458 (-) 1365 WP_014471434.1 aspartate kinase -
  PF976_RS01760 (PF976_01760) ceuB 344872..345825 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  PF976_RS01765 (PF976_01765) - 345815..346762 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  PF976_RS01770 (PF976_01770) - 346756..347514 (+) 759 WP_013351009.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=775007 PF976_RS01745 WP_013351005.1 342631..342750(+) (phrC) [Bacillus amyloliquefaciens strain SRCM124317]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=775007 PF976_RS01745 WP_013351005.1 342631..342750(+) (phrC) [Bacillus amyloliquefaciens strain SRCM124317]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821