Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   PF975_RS04855 Genome accession   NZ_CP116010
Coordinates   974700..974840 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM123815     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 969700..979840
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  PF975_RS04830 (PF975_04830) - 970003..970401 (+) 399 WP_003152031.1 YueI family protein -
  PF975_RS04835 (PF975_04835) - 970498..971049 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  PF975_RS04840 (PF975_04840) - 971067..972533 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  PF975_RS04845 (PF975_04845) - 972663..973886 (+) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  PF975_RS04850 (PF975_04850) - 973893..974234 (-) 342 WP_014418765.1 hypothetical protein -
  PF975_RS04855 (PF975_04855) degQ 974700..974840 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  PF975_RS04860 (PF975_04860) - 974992..975897 (+) 906 WP_014418764.1 polyprenyl synthetase family protein -
  PF975_RS04865 (PF975_04865) comX 975897..976067 (+) 171 WP_032863917.1 competence pheromone ComX -
  PF975_RS04870 (PF975_04870) comP 976045..978396 (+) 2352 WP_271259836.1 sensor histidine kinase Regulator
  PF975_RS04875 (PF975_04875) comA 978477..979121 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  PF975_RS04880 (PF975_04880) - 979143..979526 (+) 384 WP_014418761.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=774940 PF975_RS04855 WP_003152043.1 974700..974840(+) (degQ) [Bacillus velezensis strain SRCM123815]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=774940 PF975_RS04855 WP_003152043.1 974700..974840(+) (degQ) [Bacillus velezensis strain SRCM123815]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891