Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   OSK17_RS13405 Genome accession   NZ_CP115738
Coordinates   2561277..2561450 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain W7     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2556277..2566450
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OSK17_RS13390 (OSK17_13390) gcvT 2557077..2558165 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  OSK17_RS13395 (OSK17_13395) hepAA 2558606..2560279 (+) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  OSK17_RS13400 (OSK17_13400) yqhG 2560300..2561094 (+) 795 WP_003230200.1 YqhG family protein -
  OSK17_RS13405 (OSK17_13405) sinI 2561277..2561450 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OSK17_RS13410 (OSK17_13410) sinR 2561484..2561819 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OSK17_RS13415 (OSK17_13415) tasA 2561912..2562697 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  OSK17_RS13420 (OSK17_13420) sipW 2562761..2563333 (-) 573 WP_003246088.1 signal peptidase I SipW -
  OSK17_RS13425 (OSK17_13425) tapA 2563317..2564078 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  OSK17_RS13430 (OSK17_13430) yqzG 2564350..2564676 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OSK17_RS13435 (OSK17_13435) spoIITA 2564718..2564897 (-) 180 WP_003230176.1 YqzE family protein -
  OSK17_RS13440 (OSK17_13440) comGG 2564968..2565342 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  OSK17_RS13445 (OSK17_13445) comGF 2565343..2565726 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  OSK17_RS13450 (OSK17_13450) comGE 2565752..2566099 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=773657 OSK17_RS13405 WP_003230187.1 2561277..2561450(+) (sinI) [Bacillus subtilis strain W7]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=773657 OSK17_RS13405 WP_003230187.1 2561277..2561450(+) (sinI) [Bacillus subtilis strain W7]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1