Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   OSK17_RS13445 Genome accession   NZ_CP115738
Coordinates   2565343..2565726 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain W7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2560343..2570726
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OSK17_RS13405 (OSK17_13405) sinI 2561277..2561450 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  OSK17_RS13410 (OSK17_13410) sinR 2561484..2561819 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  OSK17_RS13415 (OSK17_13415) tasA 2561912..2562697 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  OSK17_RS13420 (OSK17_13420) sipW 2562761..2563333 (-) 573 WP_003246088.1 signal peptidase I SipW -
  OSK17_RS13425 (OSK17_13425) tapA 2563317..2564078 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  OSK17_RS13430 (OSK17_13430) yqzG 2564350..2564676 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  OSK17_RS13435 (OSK17_13435) spoIITA 2564718..2564897 (-) 180 WP_003230176.1 YqzE family protein -
  OSK17_RS13440 (OSK17_13440) comGG 2564968..2565342 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  OSK17_RS13445 (OSK17_13445) comGF 2565343..2565726 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  OSK17_RS13450 (OSK17_13450) comGE 2565752..2566099 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  OSK17_RS13455 (OSK17_13455) comGD 2566083..2566514 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  OSK17_RS13460 (OSK17_13460) comGC 2566504..2566800 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  OSK17_RS13465 (OSK17_13465) comGB 2566814..2567851 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  OSK17_RS13470 (OSK17_13470) comGA 2567838..2568908 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  OSK17_RS13475 (OSK17_13475) corA 2569319..2570272 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=773660 OSK17_RS13445 WP_041850015.1 2565343..2565726(-) (comGF) [Bacillus subtilis strain W7]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=773660 OSK17_RS13445 WP_041850015.1 2565343..2565726(-) (comGF) [Bacillus subtilis strain W7]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984