Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGF   Type   Machinery gene
Locus tag   O9K61_RS11965 Genome accession   NZ_CP115185
Coordinates   2469820..2469987 (-) Length   55 a.a.
NCBI ID   WP_235183824.1    Uniprot ID   -
Organism   Bacillus velezensis strain 26.3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2464820..2474987
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O9K61_RS11920 (O9K61_11920) - 2464940..2465734 (+) 795 WP_007408330.1 YqhG family protein -
  O9K61_RS11925 (O9K61_11925) sinI 2465911..2466084 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  O9K61_RS11930 (O9K61_11930) sinR 2466118..2466453 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  O9K61_RS11935 (O9K61_11935) tasA 2466501..2467286 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  O9K61_RS11940 (O9K61_11940) sipW 2467351..2467935 (-) 585 WP_015240205.1 signal peptidase I SipW -
  O9K61_RS11945 (O9K61_11945) tapA 2467907..2468578 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  O9K61_RS11950 (O9K61_11950) - 2468837..2469166 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  O9K61_RS11955 (O9K61_11955) - 2469206..2469385 (-) 180 WP_003153093.1 YqzE family protein -
  O9K61_RS11960 (O9K61_11960) comGG 2469442..2469819 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  O9K61_RS11965 (O9K61_11965) comGF 2469820..2469987 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  O9K61_RS11970 (O9K61_11970) - 2469984..2470178 (-) 195 WP_225917419.1 hypothetical protein -
  O9K61_RS11975 (O9K61_11975) comGE 2470222..2470536 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  O9K61_RS11980 (O9K61_11980) comGD 2470520..2470957 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  O9K61_RS11985 (O9K61_11985) comGC 2470947..2471255 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  O9K61_RS11990 (O9K61_11990) comGB 2471260..2472297 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  O9K61_RS11995 (O9K61_11995) comGA 2472284..2473354 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  O9K61_RS12000 (O9K61_12000) - 2473546..2474496 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 5847.82 Da        Isoelectric Point: 10.6868

>NTDB_id=768757 O9K61_RS11965 WP_235183824.1 2469820..2469987(-) (comGF) [Bacillus velezensis strain 26.3]
MIRKRVNGKGHVPILQNAASLTADVKNGLLLLEISSVAGQKNQAVIPVYSSFKGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=768757 O9K61_RS11965 WP_235183824.1 2469820..2469987(-) (comGF) [Bacillus velezensis strain 26.3]
ATGATAAGGAAAAGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAA
CGGCCTGCTCTTATTAGAGATTTCAAGCGTTGCAGGTCAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

51.852

98.182

0.509