Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   O9K61_RS11925 Genome accession   NZ_CP115185
Coordinates   2465911..2466084 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain 26.3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2460911..2471084
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O9K61_RS11910 (O9K61_11910) gcvT 2461724..2462824 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  O9K61_RS11915 (O9K61_11915) - 2463248..2464918 (+) 1671 WP_007408331.1 DEAD/DEAH box helicase -
  O9K61_RS11920 (O9K61_11920) - 2464940..2465734 (+) 795 WP_007408330.1 YqhG family protein -
  O9K61_RS11925 (O9K61_11925) sinI 2465911..2466084 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  O9K61_RS11930 (O9K61_11930) sinR 2466118..2466453 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  O9K61_RS11935 (O9K61_11935) tasA 2466501..2467286 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  O9K61_RS11940 (O9K61_11940) sipW 2467351..2467935 (-) 585 WP_015240205.1 signal peptidase I SipW -
  O9K61_RS11945 (O9K61_11945) tapA 2467907..2468578 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  O9K61_RS11950 (O9K61_11950) - 2468837..2469166 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  O9K61_RS11955 (O9K61_11955) - 2469206..2469385 (-) 180 WP_003153093.1 YqzE family protein -
  O9K61_RS11960 (O9K61_11960) comGG 2469442..2469819 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  O9K61_RS11965 (O9K61_11965) comGF 2469820..2469987 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  O9K61_RS11970 (O9K61_11970) - 2469984..2470178 (-) 195 WP_225917419.1 hypothetical protein -
  O9K61_RS11975 (O9K61_11975) comGE 2470222..2470536 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  O9K61_RS11980 (O9K61_11980) comGD 2470520..2470957 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=768754 O9K61_RS11925 WP_003153105.1 2465911..2466084(+) (sinI) [Bacillus velezensis strain 26.3]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=768754 O9K61_RS11925 WP_003153105.1 2465911..2466084(+) (sinI) [Bacillus velezensis strain 26.3]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702