Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   O0957_RS04090 Genome accession   NZ_CP114552
Coordinates   779640..780158 (-) Length   172 a.a.
NCBI ID   WP_005721894.1    Uniprot ID   -
Organism   Lactobacillus crispatus strain Lcr-MH175     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 771469..804757 779640..780158 within 0


Gene organization within MGE regions


Location: 771469..804757
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O0957_RS04055 (O0957_04055) - 771469..773073 (-) 1605 WP_005721054.1 ATP-binding cassette domain-containing protein -
  O0957_RS04060 (O0957_04060) - 773171..774100 (-) 930 WP_005721896.1 DegV family protein -
  O0957_RS04065 (O0957_04065) - 774210..775145 (-) 936 WP_005721051.1 phosphate/phosphite/phosphonate ABC transporter substrate-binding protein -
  O0957_RS04070 (O0957_04070) dnaB 775313..776704 (-) 1392 WP_005721050.1 replicative DNA helicase -
  O0957_RS04075 (O0957_04075) rplI 776724..777179 (-) 456 WP_005721048.1 50S ribosomal protein L9 -
  O0957_RS04080 (O0957_04080) - 777191..779212 (-) 2022 WP_005721046.1 DHH family phosphoesterase -
  O0957_RS04085 (O0957_04085) rpsR 779376..779612 (-) 237 WP_003549366.1 30S ribosomal protein S18 -
  O0957_RS04090 (O0957_04090) ssb 779640..780158 (-) 519 WP_005721894.1 single-stranded DNA-binding protein Machinery gene
  O0957_RS04095 (O0957_04095) rpsF 780208..780504 (-) 297 WP_005721042.1 30S ribosomal protein S6 -
  O0957_RS04100 (O0957_04100) gyrA 780721..783201 (-) 2481 WP_269563602.1 DNA gyrase subunit A -
  O0957_RS04105 (O0957_04105) gyrB 783211..785175 (-) 1965 WP_005721039.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  O0957_RS04110 (O0957_04110) recF 785176..786303 (-) 1128 WP_005721038.1 DNA replication/repair protein RecF -
  O0957_RS04115 (O0957_04115) yaaA 786312..786533 (-) 222 WP_005721893.1 S4 domain-containing protein YaaA -
  O0957_RS04120 (O0957_04120) ltrA 786769..788067 (-) 1299 WP_005721168.1 group II intron reverse transcriptase/maturase -
  O0957_RS04125 (O0957_04125) dnaN 788683..789813 (-) 1131 WP_005721892.1 DNA polymerase III subunit beta -
  O0957_RS04130 (O0957_04130) dnaA 789988..791355 (-) 1368 WP_005721034.1 chromosomal replication initiator protein DnaA -
  O0957_RS04135 (O0957_04135) - 791840..792874 (+) 1035 WP_005729423.1 IS30 family transposase -
  O0957_RS04140 (O0957_04140) rpmH 793008..793148 (+) 141 WP_003549412.1 50S ribosomal protein L34 -
  O0957_RS04145 (O0957_04145) rnpA 793200..793568 (+) 369 WP_005720766.1 ribonuclease P protein component -
  O0957_RS04150 (O0957_04150) - 793570..794445 (+) 876 WP_005721891.1 YidC/Oxa1 family membrane protein insertase -
  O0957_RS04155 (O0957_04155) mnmE 794556..795941 (+) 1386 WP_005720764.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis GTPase MnmE -
  O0957_RS04160 (O0957_04160) mnmG 795949..797847 (+) 1899 WP_005724731.1 tRNA uridine-5-carboxymethylaminomethyl(34) synthesis enzyme MnmG -
  O0957_RS04165 (O0957_04165) spxB 798216..800024 (+) 1809 WP_005721890.1 pyruvate oxidase -
  O0957_RS04170 (O0957_04170) - 800238..800507 (+) 270 WP_005720761.1 hypothetical protein -
  O0957_RS04175 (O0957_04175) gndA 800809..802212 (+) 1404 WP_005721889.1 NADP-dependent phosphogluconate dehydrogenase -
  O0957_RS04180 (O0957_04180) - 802315..803874 (+) 1560 WP_005720758.1 ClC family H(+)/Cl(-) exchange transporter -
  O0957_RS04185 (O0957_04185) - 803983..804408 (-) 426 WP_005720757.1 ImmA/IrrE family metallo-endopeptidase -
  O0957_RS04190 (O0957_04190) - 804386..804757 (-) 372 WP_005721887.1 helix-turn-helix domain-containing protein -

Sequence


Protein


Download         Length: 172 a.a.        Molecular weight: 18679.21 Da        Isoelectric Point: 4.7317

>NTDB_id=766386 O0957_RS04090 WP_005721894.1 779640..780158(-) (ssb) [Lactobacillus crispatus strain Lcr-MH175]
MINRVVLVGRLTRDPELRTTGSGISVATFTLAVDRQFTNSQGERGADFVSCVIWRKSAENFCNFTSKGSLVGIDGRIQTR
SYDNKDGQRVYVTEVVVDNFALLESRKDREARGQNGGYTPNSGNASSQPANNFPNNGGSQGNSQTNNNQNNSQDPFSGSG
DTIDISDDDLPF

Nucleotide


Download         Length: 519 bp        

>NTDB_id=766386 O0957_RS04090 WP_005721894.1 779640..780158(-) (ssb) [Lactobacillus crispatus strain Lcr-MH175]
ATGATTAATAGAGTTGTACTTGTTGGCCGTTTAACACGTGATCCTGAATTACGTACTACTGGGAGTGGAATCTCGGTTGC
TACGTTTACTCTTGCTGTTGACCGTCAATTTACAAATAGCCAAGGTGAGAGAGGCGCAGATTTCGTCAGCTGTGTAATTT
GGAGAAAGTCAGCAGAAAACTTCTGCAACTTTACTTCAAAGGGTTCATTAGTTGGAATTGATGGCCGAATTCAAACCAGA
AGTTATGATAATAAAGATGGGCAAAGGGTATATGTAACCGAAGTTGTTGTTGATAACTTCGCATTGCTCGAATCACGCAA
GGATCGTGAAGCCCGCGGTCAAAATGGTGGTTATACACCAAATAGTGGAAATGCTAGCAGTCAACCTGCTAACAATTTCC
CAAATAATGGCGGATCACAAGGTAATTCACAGACTAATAACAATCAAAATAATTCACAAGATCCATTTAGTGGCTCAGGT
GATACGATTGATATTTCTGATGACGATCTACCATTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

61.143

100

0.622

  ssbA Bacillus subtilis subsp. subtilis str. 168

51.705

100

0.529