Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QNK10_RS16005 Genome accession   NZ_CP125982
Coordinates   2988827..2988967 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain ZKY05     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 2983827..2993967
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK10_RS15980 (QNK10_16010) yuxO 2984104..2984484 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  QNK10_RS15985 (QNK10_16015) comA 2984503..2985147 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QNK10_RS15990 (QNK10_16020) comP 2985228..2987540 (-) 2313 WP_069964288.1 sensor histidine kinase Regulator
  QNK10_RS15995 (QNK10_16025) comX 2987556..2987777 (-) 222 WP_014480704.1 competence pheromone ComX -
  QNK10_RS16000 (QNK10_16030) comQ 2987779..2988642 (-) 864 WP_014480705.1 polyprenyl synthetase family protein Regulator
  QNK10_RS16005 (QNK10_16035) degQ 2988827..2988967 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QNK10_RS16010 (QNK10_16040) - 2989189..2989314 (+) 126 WP_003228793.1 hypothetical protein -
  QNK10_RS16015 (QNK10_16045) - 2989429..2989797 (+) 369 WP_046381300.1 hypothetical protein -
  QNK10_RS16020 (QNK10_16050) pdeH 2989773..2991002 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  QNK10_RS16025 (QNK10_16055) pncB 2991139..2992611 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QNK10_RS16030 (QNK10_16060) pncA 2992627..2993178 (-) 552 WP_014477836.1 cysteine hydrolase family protein -
  QNK10_RS16035 (QNK10_16065) yueI 2993275..2993673 (-) 399 WP_015251331.1 YueI family protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=765891 QNK10_RS16005 WP_003220708.1 2988827..2988967(-) (degQ) [Bacillus subtilis strain ZKY05]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=765891 QNK10_RS16005 WP_003220708.1 2988827..2988967(-) (degQ) [Bacillus subtilis strain ZKY05]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1