Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   M1L51_RS11670 Genome accession   NZ_CP114180
Coordinates   2457735..2458112 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain DMW1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2452735..2463112
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1L51_RS11630 - 2453233..2454027 (+) 795 WP_007408330.1 YqhG family protein -
  M1L51_RS11635 sinI 2454204..2454377 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  M1L51_RS11640 sinR 2454411..2454746 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M1L51_RS11645 tasA 2454794..2455579 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  M1L51_RS11650 sipW 2455644..2456228 (-) 585 WP_015240205.1 signal peptidase I SipW -
  M1L51_RS11655 tapA 2456200..2456871 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  M1L51_RS11660 - 2457130..2457459 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  M1L51_RS11665 - 2457499..2457678 (-) 180 WP_003153093.1 YqzE family protein -
  M1L51_RS11670 comGG 2457735..2458112 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  M1L51_RS11675 comGF 2458113..2458613 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  M1L51_RS11680 comGE 2458522..2458836 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M1L51_RS11685 comGD 2458820..2459257 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  M1L51_RS11690 comGC 2459247..2459555 (-) 309 WP_079979070.1 competence type IV pilus major pilin ComGC Machinery gene
  M1L51_RS11695 comGB 2459560..2460597 (-) 1038 WP_053573197.1 competence type IV pilus assembly protein ComGB Machinery gene
  M1L51_RS11700 comGA 2460584..2461654 (-) 1071 WP_053573196.1 competence type IV pilus ATPase ComGA Machinery gene
  M1L51_RS11705 - 2461847..2462797 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=764789 M1L51_RS11670 WP_015417814.1 2457735..2458112(-) (comGG) [Bacillus velezensis strain DMW1]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=764789 M1L51_RS11670 WP_015417814.1 2457735..2458112(-) (comGG) [Bacillus velezensis strain DMW1]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAATACTGGATCGGAGAGAACTTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504