Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   M1L51_RS11635 Genome accession   NZ_CP114180
Coordinates   2454204..2454377 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain DMW1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2449204..2459377
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  M1L51_RS11620 gcvT 2450017..2451117 (-) 1101 WP_053573200.1 glycine cleavage system aminomethyltransferase GcvT -
  M1L51_RS11625 - 2451541..2453211 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  M1L51_RS11630 - 2453233..2454027 (+) 795 WP_007408330.1 YqhG family protein -
  M1L51_RS11635 sinI 2454204..2454377 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  M1L51_RS11640 sinR 2454411..2454746 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  M1L51_RS11645 tasA 2454794..2455579 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  M1L51_RS11650 sipW 2455644..2456228 (-) 585 WP_015240205.1 signal peptidase I SipW -
  M1L51_RS11655 tapA 2456200..2456871 (-) 672 WP_053573199.1 amyloid fiber anchoring/assembly protein TapA -
  M1L51_RS11660 - 2457130..2457459 (+) 330 WP_039254490.1 DUF3889 domain-containing protein -
  M1L51_RS11665 - 2457499..2457678 (-) 180 WP_003153093.1 YqzE family protein -
  M1L51_RS11670 comGG 2457735..2458112 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  M1L51_RS11675 comGF 2458113..2458613 (-) 501 WP_256052909.1 competence type IV pilus minor pilin ComGF -
  M1L51_RS11680 comGE 2458522..2458836 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  M1L51_RS11685 comGD 2458820..2459257 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=764787 M1L51_RS11635 WP_003153105.1 2454204..2454377(+) (sinI) [Bacillus velezensis strain DMW1]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=764787 M1L51_RS11635 WP_003153105.1 2454204..2454377(+) (sinI) [Bacillus velezensis strain DMW1]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702