Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   O0R52_RS12635 Genome accession   NZ_CP114066
Coordinates   2520820..2521194 (-) Length   124 a.a.
NCBI ID   WP_217827777.1    Uniprot ID   -
Organism   Bacillus halotolerans strain B13     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2515820..2526194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  O0R52_RS12595 (O0R52_12595) - 2516153..2516947 (+) 795 WP_256766236.1 YqhG family protein -
  O0R52_RS12600 (O0R52_12600) sinI 2517131..2517304 (+) 174 WP_024122036.1 anti-repressor SinI Regulator
  O0R52_RS12605 (O0R52_12605) sinR 2517338..2517673 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  O0R52_RS12610 (O0R52_12610) tasA 2517759..2518544 (-) 786 WP_059293609.1 biofilm matrix protein TasA -
  O0R52_RS12615 (O0R52_12615) sipW 2518609..2519193 (-) 585 WP_059293608.1 signal peptidase I SipW -
  O0R52_RS12620 (O0R52_12620) tapA 2519165..2519926 (-) 762 WP_217827776.1 amyloid fiber anchoring/assembly protein TapA -
  O0R52_RS12625 (O0R52_12625) - 2520203..2520526 (+) 324 WP_024122040.1 YqzG/YhdC family protein -
  O0R52_RS12630 (O0R52_12630) - 2520569..2520748 (-) 180 WP_003236949.1 YqzE family protein -
  O0R52_RS12635 (O0R52_12635) comGG 2520820..2521194 (-) 375 WP_217827777.1 competence type IV pilus minor pilin ComGG Machinery gene
  O0R52_RS12640 (O0R52_12640) comGF 2521195..2521578 (-) 384 WP_217827778.1 competence type IV pilus minor pilin ComGF Machinery gene
  O0R52_RS12645 (O0R52_12645) comGE 2521604..2521951 (-) 348 WP_217827779.1 competence type IV pilus minor pilin ComGE Machinery gene
  O0R52_RS12650 (O0R52_12650) comGD 2521935..2522366 (-) 432 WP_217827780.1 competence type IV pilus minor pilin ComGD Machinery gene
  O0R52_RS12655 (O0R52_12655) comGC 2522356..2522652 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  O0R52_RS12660 (O0R52_12660) comGB 2522666..2523703 (-) 1038 WP_217827781.1 competence type IV pilus assembly protein ComGB Machinery gene
  O0R52_RS12665 (O0R52_12665) comGA 2523690..2524760 (-) 1071 WP_217827782.1 competence protein ComGA Machinery gene
  O0R52_RS12670 (O0R52_12670) - 2525082..2525492 (-) 411 WP_217827783.1 CBS domain-containing protein -

Sequence


Protein


Download         Length: 124 a.a.        Molecular weight: 14497.58 Da        Isoelectric Point: 9.2100

>NTDB_id=764390 O0R52_RS12635 WP_217827777.1 2520820..2521194(-) (comGG) [Bacillus halotolerans strain B13]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEKETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTINEQQEITLKAITESGTEKNAQLLFDQNQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=764390 O0R52_RS12635 WP_217827777.1 2520820..2521194(-) (comGG) [Bacillus halotolerans strain B13]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCCGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGAAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAACAACCATAAATGAACAGCAAGAAATCACCCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAA
CGCTCAGCTGCTGTTCGATCAAAATCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains


Predicted by InterproScan.

(31-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

68.548

100

0.685