Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | OZA25_RS10215 | Genome accession | NZ_CP114038 |
| Coordinates | 1958875..1959048 (-) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain B8 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1953875..1964048
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OZA25_RS10165 (OZA25_10165) | comGD | 1953994..1954431 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| OZA25_RS10170 (OZA25_10170) | comGE | 1954415..1954729 (+) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| OZA25_RS10175 (OZA25_10175) | comGF | 1954638..1955138 (+) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| OZA25_RS10180 (OZA25_10180) | comGG | 1955139..1955516 (+) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| OZA25_RS10185 (OZA25_10185) | - | 1955573..1955752 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| OZA25_RS10190 (OZA25_10190) | - | 1955793..1956122 (-) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| OZA25_RS10195 (OZA25_10195) | tapA | 1956381..1957052 (+) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| OZA25_RS10200 (OZA25_10200) | sipW | 1957024..1957608 (+) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| OZA25_RS10205 (OZA25_10205) | tasA | 1957673..1958458 (+) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| OZA25_RS10210 (OZA25_10210) | sinR | 1958506..1958841 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| OZA25_RS10215 (OZA25_10215) | sinI | 1958875..1959048 (-) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| OZA25_RS10220 (OZA25_10220) | - | 1959225..1960019 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| OZA25_RS10225 (OZA25_10225) | - | 1960041..1961711 (-) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| OZA25_RS10230 (OZA25_10230) | gcvT | 1962134..1963234 (+) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=764190 OZA25_RS10215 WP_032874029.1 1958875..1959048(-) (sinI) [Bacillus velezensis strain B8]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=764190 OZA25_RS10215 WP_032874029.1 1958875..1959048(-) (sinI) [Bacillus velezensis strain B8]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |