Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   OZA25_RS10180 Genome accession   NZ_CP114038
Coordinates   1955139..1955516 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain B8     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1950139..1960516
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OZA25_RS10145 (OZA25_10145) - 1950450..1951400 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  OZA25_RS10150 (OZA25_10150) comGA 1951597..1952667 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  OZA25_RS10155 (OZA25_10155) comGB 1952654..1953691 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  OZA25_RS10160 (OZA25_10160) comGC 1953738..1954004 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  OZA25_RS10165 (OZA25_10165) comGD 1953994..1954431 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  OZA25_RS10170 (OZA25_10170) comGE 1954415..1954729 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  OZA25_RS10175 (OZA25_10175) comGF 1954638..1955138 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  OZA25_RS10180 (OZA25_10180) comGG 1955139..1955516 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  OZA25_RS10185 (OZA25_10185) - 1955573..1955752 (+) 180 WP_022552966.1 YqzE family protein -
  OZA25_RS10190 (OZA25_10190) - 1955793..1956122 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  OZA25_RS10195 (OZA25_10195) tapA 1956381..1957052 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  OZA25_RS10200 (OZA25_10200) sipW 1957024..1957608 (+) 585 WP_032874025.1 signal peptidase I SipW -
  OZA25_RS10205 (OZA25_10205) tasA 1957673..1958458 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  OZA25_RS10210 (OZA25_10210) sinR 1958506..1958841 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  OZA25_RS10215 (OZA25_10215) sinI 1958875..1959048 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  OZA25_RS10220 (OZA25_10220) - 1959225..1960019 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=764188 OZA25_RS10180 WP_032874019.1 1955139..1955516(+) (comGG) [Bacillus velezensis strain B8]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=764188 OZA25_RS10180 WP_032874019.1 1955139..1955516(+) (comGG) [Bacillus velezensis strain B8]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488