Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   OU989_RS22325 Genome accession   NZ_CP113527
Coordinates   4430590..4431159 (-) Length   189 a.a.
NCBI ID   WP_274795087.1    Uniprot ID   -
Organism   Lysinibacillus irui strain IRB4-01     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 4370753..4439848 4430590..4431159 within 0


Gene organization within MGE regions


Location: 4370753..4439848
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OU989_RS22050 (OU989_22085) - 4370753..4371943 (+) 1191 WP_274795031.1 M14 family metallopeptidase -
  OU989_RS22055 (OU989_22090) - 4372131..4372460 (+) 330 WP_274795032.1 PadR family transcriptional regulator -
  OU989_RS22060 (OU989_22095) - 4372457..4372864 (+) 408 WP_274795033.1 permease prefix domain 1-containing protein -
  OU989_RS22065 (OU989_22100) - 4373158..4373523 (+) 366 WP_274795034.1 hypothetical protein -
  OU989_RS22070 (OU989_22105) - 4373723..4374130 (+) 408 WP_312506380.1 MarR family transcriptional regulator -
  OU989_RS22075 (OU989_22110) - 4374276..4374935 (+) 660 WP_274795036.1 hypothetical protein -
  OU989_RS22080 (OU989_22115) - 4374932..4375213 (+) 282 WP_274795037.1 hypothetical protein -
  OU989_RS22085 (OU989_22120) - 4375332..4376411 (-) 1080 WP_274795038.1 ankyrin repeat domain-containing protein -
  OU989_RS22090 (OU989_22125) - 4376639..4378120 (-) 1482 WP_274795039.1 malate:quinone oxidoreductase -
  OU989_RS22095 (OU989_22130) - 4378509..4379279 (-) 771 WP_274795040.1 nucleotidyltransferase domain-containing protein -
  OU989_RS22100 (OU989_22135) - 4379399..4379548 (-) 150 WP_274797399.1 hypothetical protein -
  OU989_RS22105 (OU989_22140) - 4379705..4380196 (+) 492 WP_274795041.1 hypothetical protein -
  OU989_RS22110 (OU989_22145) - 4380263..4380538 (-) 276 WP_274795042.1 hypothetical protein -
  OU989_RS22115 (OU989_22150) - 4380712..4380924 (-) 213 WP_274795044.1 hypothetical protein -
  OU989_RS22120 (OU989_22155) - 4381152..4381883 (+) 732 WP_274795045.1 GntR family transcriptional regulator -
  OU989_RS22125 (OU989_22160) gntK 4381876..4383417 (+) 1542 WP_274795046.1 gluconokinase -
  OU989_RS22130 (OU989_22165) - 4383433..4384779 (+) 1347 WP_274795047.1 GntP family permease -
  OU989_RS22135 (OU989_22170) gnd 4384806..4386206 (+) 1401 WP_274795048.1 decarboxylating NADP(+)-dependent phosphogluconate dehydrogenase -
  OU989_RS22140 (OU989_22175) - 4386267..4387796 (-) 1530 WP_274795049.1 histidine kinase N-terminal 7TM domain-containing protein -
  OU989_RS22145 (OU989_22180) - 4387910..4388242 (+) 333 WP_274795050.1 BRCT domain-containing protein -
  OU989_RS22150 (OU989_22185) - 4388284..4389375 (-) 1092 WP_274795051.1 DUF4179 domain-containing protein -
  OU989_RS22155 (OU989_22190) - 4389372..4389926 (-) 555 WP_274795052.1 sigma-70 family RNA polymerase sigma factor -
  OU989_RS22160 (OU989_22195) - 4390107..4390781 (-) 675 WP_274795053.1 peptidylprolyl isomerase -
  OU989_RS22165 (OU989_22200) - 4391184..4393961 (+) 2778 WP_274795054.1 EAL domain-containing protein -
  OU989_RS22170 (OU989_22205) - 4393994..4395631 (+) 1638 WP_274795055.1 thiamine pyrophosphate-binding protein -
  OU989_RS22175 (OU989_22210) - 4395764..4396357 (-) 594 WP_274795056.1 hypothetical protein -
  OU989_RS22180 (OU989_22215) - 4396501..4398381 (-) 1881 WP_274795057.1 leucine-rich repeat domain-containing protein -
  OU989_RS22185 (OU989_22220) - 4398599..4399576 (+) 978 WP_274795058.1 tRNA-dihydrouridine synthase -
  OU989_RS22190 (OU989_22225) - 4399675..4400565 (-) 891 WP_274795059.1 LysR family transcriptional regulator -
  OU989_RS22195 (OU989_22230) - 4400686..4402689 (+) 2004 WP_274795060.1 YhgE/Pip family protein -
  OU989_RS22200 (OU989_22235) - 4402944..4403483 (-) 540 WP_274795061.1 VUT family protein -
  OU989_RS22205 (OU989_22240) queE 4403531..4404259 (-) 729 WP_274795062.1 7-carboxy-7-deazaguanine synthase QueE -
  OU989_RS22210 (OU989_22245) queD 4404252..4404722 (-) 471 WP_274795063.1 6-carboxytetrahydropterin synthase QueD -
  OU989_RS22215 (OU989_22250) queC 4404726..4405385 (-) 660 WP_274795064.1 7-cyano-7-deazaguanine synthase QueC -
  OU989_RS22220 (OU989_22255) queF 4405490..4405990 (-) 501 WP_274795066.1 preQ(1) synthase -
  OU989_RS22225 (OU989_22260) - 4406493..4410194 (+) 3702 WP_274795067.1 S8 family serine peptidase -
  OU989_RS22230 (OU989_22265) - 4410442..4411170 (-) 729 WP_396631789.1 amino acid ABC transporter ATP-binding protein -
  OU989_RS22235 (OU989_22270) - 4411198..4411863 (-) 666 WP_274795069.1 amino acid ABC transporter permease -
  OU989_RS22240 (OU989_22275) - 4411895..4412677 (-) 783 WP_274795070.1 transporter substrate-binding domain-containing protein -
  OU989_RS22245 (OU989_22280) rlmH 4412908..4413387 (-) 480 WP_274795071.1 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH -
  OU989_RS22250 (OU989_22285) - 4413478..4413642 (-) 165 WP_274795073.1 CxxH/CxxC protein -
  OU989_RS22255 (OU989_22290) - 4413878..4415170 (-) 1293 WP_274795075.1 S1C family serine protease -
  OU989_RS22260 (OU989_22295) - 4415338..4416126 (-) 789 WP_274795076.1 MBL fold metallo-hydrolase -
  OU989_RS22265 (OU989_22300) - 4416126..4416953 (-) 828 WP_274795077.1 two-component system regulatory protein YycI -
  OU989_RS22270 (OU989_22305) - 4416940..4418265 (-) 1326 WP_274795078.1 YycH family regulatory protein -
  OU989_RS22275 (OU989_22310) walK 4418262..4420127 (-) 1866 WP_274795079.1 cell wall metabolism sensor histidine kinase WalK -
  OU989_RS22280 (OU989_22315) yycF 4420133..4420846 (-) 714 WP_274795080.1 response regulator YycF -
  OU989_RS22285 (OU989_22320) - 4421059..4422522 (-) 1464 WP_274795081.1 M23 family metallopeptidase -
  OU989_RS22290 (OU989_22325) - 4422902..4423765 (+) 864 WP_274797396.1 YitT family protein -
  OU989_RS22295 (OU989_22330) - 4423813..4425102 (-) 1290 WP_274795082.1 adenylosuccinate synthase -
  OU989_RS22300 (OU989_22335) dnaB 4425339..4426700 (-) 1362 WP_004233370.1 replicative DNA helicase -
  OU989_RS22305 (OU989_22340) rplI 4426714..4427160 (-) 447 WP_274795084.1 50S ribosomal protein L9 -
  OU989_RS22310 (OU989_22345) - 4427160..4429130 (-) 1971 WP_274795085.1 DHH family phosphoesterase -
  OU989_RS22315 (OU989_22350) - 4429144..4430085 (-) 942 WP_274795086.1 YybS family protein -
  OU989_RS22320 (OU989_22355) rpsR 4430313..4430549 (-) 237 WP_012296211.1 30S ribosomal protein S18 -
  OU989_RS22325 (OU989_22360) ssbA 4430590..4431159 (-) 570 WP_274795087.1 single-stranded DNA-binding protein Machinery gene
  OU989_RS22330 (OU989_22365) rpsF 4431203..4431490 (-) 288 WP_274795088.1 30S ribosomal protein S6 -
  OU989_RS22335 (OU989_22370) - 4431668..4432237 (+) 570 WP_274795089.1 DUF3267 domain-containing protein -
  OU989_RS22340 (OU989_22375) - 4432287..4433372 (-) 1086 WP_274795090.1 acyl-CoA dehydrogenase -
  OU989_RS22345 (OU989_22380) ychF 4433412..4434512 (-) 1101 WP_274795091.1 redox-regulated ATPase YchF -
  OU989_RS22350 (OU989_22385) - 4434610..4434810 (-) 201 WP_274795092.1 DUF951 domain-containing protein -
  OU989_RS22355 (OU989_22390) - 4434812..4435687 (-) 876 WP_274797397.1 mechanosensitive ion channel family protein -
  OU989_RS22360 (OU989_22395) yyaC 4435779..4436411 (+) 633 WP_274795093.1 spore protease YyaC -
  OU989_RS22365 (OU989_22400) - 4436328..4437044 (-) 717 WP_274795094.1 DUF554 domain-containing protein -
  OU989_RS22370 (OU989_22405) - 4437123..4437971 (-) 849 WP_274795095.1 ParB/RepB/Spo0J family partition protein -
  OU989_RS22375 (OU989_22410) - 4437964..4438725 (-) 762 WP_274795096.1 ParA family protein -
  OU989_RS22380 (OU989_22415) noc 4438949..4439848 (-) 900 WP_274795098.1 nucleoid occlusion protein -

Sequence

Protein


Download         Length: 189 a.a.        Molecular weight: 20566.54 Da        Isoelectric Point: 4.7719

>NTDB_id=762794 OU989_RS22325 WP_274795087.1 4430590..4431159(-) (ssbA) [Lysinibacillus irui strain IRB4-01]
MINRVVLVGRLTKDPELRYTPNGIASTRFTVAVNRAFSNQQGEREADFISCVAWRKQAENLANFMRKGSLIGVEGRIQTG
SYEGQDGKRVYTTDVVADSVQFLEPRNGSGAAAPQYGGGQTYGNNQPSYGGGQPQQQFGGAMPGQGSYGGDTYQQNQPPM
NQPNYTRVDEDPFANSKGPIEVSEDDLPF

Nucleotide


Download         Length: 570 bp        

>NTDB_id=762794 OU989_RS22325 WP_274795087.1 4430590..4431159(-) (ssbA) [Lysinibacillus irui strain IRB4-01]
ATGATAAACCGTGTCGTATTAGTTGGAAGACTAACAAAAGATCCTGAGCTACGTTATACACCGAACGGAATTGCGTCTAC
AAGATTTACAGTTGCTGTAAACCGTGCATTCTCAAATCAACAAGGTGAACGCGAAGCTGATTTCATTAGCTGTGTTGCAT
GGCGAAAACAGGCCGAAAACCTAGCGAACTTCATGCGAAAAGGAAGTTTAATTGGGGTAGAAGGTCGTATCCAAACGGGC
AGTTATGAAGGACAAGACGGTAAGCGAGTATATACAACAGATGTCGTGGCGGATAGCGTACAGTTTTTAGAACCACGTAA
TGGTAGCGGCGCTGCTGCTCCTCAATACGGTGGTGGACAAACTTACGGTAATAACCAACCGTCATATGGCGGTGGTCAGC
CACAACAACAGTTTGGTGGCGCTATGCCAGGGCAGGGTTCCTATGGCGGCGATACTTATCAACAAAATCAACCACCTATG
AATCAGCCGAATTATACACGTGTAGATGAGGATCCATTTGCGAATAGCAAAGGACCGATAGAAGTATCTGAGGATGATCT
TCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.968

100

0.54
  ssb Latilactobacillus sakei subsp. sakei 23K

48.148

100

0.481