Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   OU809_RS13235 Genome accession   NZ_CP113516
Coordinates   2669989..2670165 (+) Length   58 a.a.
NCBI ID   WP_023855184.1    Uniprot ID   -
Organism   Bacillus paralicheniformis strain 285-3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2664989..2675165
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OU809_RS13220 (OU809_13220) gcvT 2665629..2666723 (-) 1095 WP_023855182.1 glycine cleavage system aminomethyltransferase GcvT -
  OU809_RS13225 (OU809_13225) - 2667318..2668997 (+) 1680 WP_020452163.1 DEAD/DEAH box helicase -
  OU809_RS13230 (OU809_13230) - 2669004..2669798 (+) 795 WP_020452164.1 YqhG family protein -
  OU809_RS13235 (OU809_13235) sinI 2669989..2670165 (+) 177 WP_023855184.1 anti-repressor SinI Regulator
  OU809_RS13240 (OU809_13240) sinR 2670199..2670534 (+) 336 WP_023855185.1 transcriptional regulator SinR Regulator
  OU809_RS13245 (OU809_13245) tasA 2670639..2671433 (-) 795 WP_020452167.1 biofilm matrix protein TasA -
  OU809_RS13250 (OU809_13250) sipW 2671506..2672090 (-) 585 WP_020452168.1 signal peptidase I SipW -
  OU809_RS13255 (OU809_13255) tapA 2672087..2672815 (-) 729 WP_268050583.1 amyloid fiber anchoring/assembly protein TapA -
  OU809_RS13260 (OU809_13260) - 2673093..2673413 (+) 321 WP_023855188.1 YqzG/YhdC family protein -
  OU809_RS13265 (OU809_13265) - 2673443..2673625 (-) 183 WP_020452171.1 YqzE family protein -
  OU809_RS13270 (OU809_13270) comGG 2673714..2674079 (-) 366 WP_025811163.1 competence type IV pilus minor pilin ComGG -
  OU809_RS13275 (OU809_13275) comGF 2674091..2674579 (-) 489 WP_224067282.1 competence type IV pilus minor pilin ComGF -
  OU809_RS13280 (OU809_13280) comGE 2674488..2674835 (-) 348 WP_023855191.1 competence type IV pilus minor pilin ComGE -

Sequence


Protein


Download         Length: 58 a.a.        Molecular weight: 6709.46 Da        Isoelectric Point: 4.5938

>NTDB_id=762608 OU809_RS13235 WP_023855184.1 2669989..2670165(+) (sinI) [Bacillus paralicheniformis strain 285-3]
MNKDKNEKEELDEEWTELIKHALEQGISPEDIRIFLNLGEKSSKPSASIERSHSINPF

Nucleotide


Download         Length: 177 bp        

>NTDB_id=762608 OU809_RS13235 WP_023855184.1 2669989..2670165(+) (sinI) [Bacillus paralicheniformis strain 285-3]
ATGAATAAAGATAAAAATGAGAAAGAAGAATTGGATGAGGAGTGGACAGAACTGATTAAACACGCTCTTGAACAAGGCAT
TAGTCCAGAGGATATACGTATTTTTCTCAATTTGGGTGAGAAGTCTTCAAAACCTTCCGCATCAATTGAAAGAAGTCATT
CAATAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

50

100

0.5