Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ORP33_RS16080 Genome accession   NZ_CP113256
Coordinates   3095919..3096059 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain K1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3090919..3101059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORP33_RS16055 (ORP33_15695) yuxO 3091269..3091649 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  ORP33_RS16060 (ORP33_15700) comA 3091668..3092312 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  ORP33_RS16065 (ORP33_15705) comP 3092393..3094690 (-) 2298 WP_267932966.1 histidine kinase Regulator
  ORP33_RS16070 (ORP33_15710) comX 3094698..3094859 (-) 162 WP_049140565.1 competence pheromone ComX -
  ORP33_RS16075 (ORP33_15715) - 3094874..3095734 (-) 861 WP_040081966.1 polyprenyl synthetase family protein -
  ORP33_RS16080 (ORP33_15720) degQ 3095919..3096059 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  ORP33_RS16085 - 3096281..3096406 (+) 126 WP_121549029.1 hypothetical protein -
  ORP33_RS16090 (ORP33_15725) - 3096520..3096888 (+) 369 WP_213414936.1 hypothetical protein -
  ORP33_RS16095 (ORP33_15730) pdeH 3096864..3098093 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  ORP33_RS16100 (ORP33_15735) pncB 3098230..3099702 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  ORP33_RS16105 (ORP33_15740) pncA 3099718..3100269 (-) 552 WP_015714627.1 cysteine hydrolase family protein -
  ORP33_RS16110 (ORP33_15745) yueI 3100366..3100764 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=761283 ORP33_RS16080 WP_003220708.1 3095919..3096059(-) (degQ) [Bacillus subtilis strain K1]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=761283 ORP33_RS16080 WP_003220708.1 3095919..3096059(-) (degQ) [Bacillus subtilis strain K1]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1