Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ORP33_RS12285 Genome accession   NZ_CP113256
Coordinates   2403342..2403725 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis strain K1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2398342..2408725
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORP33_RS12245 (ORP33_12005) sinI 2399276..2399449 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ORP33_RS12250 (ORP33_12010) sinR 2399483..2399818 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ORP33_RS12255 (ORP33_12015) tasA 2399911..2400696 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ORP33_RS12260 (ORP33_12020) sipW 2400760..2401332 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ORP33_RS12265 (ORP33_12025) tapA 2401316..2402077 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ORP33_RS12270 (ORP33_12030) yqzG 2402349..2402675 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  ORP33_RS12275 (ORP33_12035) spoIITA 2402717..2402896 (-) 180 WP_213414620.1 YqzE family protein -
  ORP33_RS12280 (ORP33_12040) comGG 2402967..2403341 (-) 375 WP_225722048.1 ComG operon protein ComGG Machinery gene
  ORP33_RS12285 (ORP33_12045) comGF 2403342..2403725 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ORP33_RS12290 (ORP33_12050) comGE 2403751..2404098 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  ORP33_RS12295 (ORP33_12055) comGD 2404082..2404513 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  ORP33_RS12300 (ORP33_12060) comGC 2404503..2404799 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  ORP33_RS12305 (ORP33_12065) comGB 2404813..2405850 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  ORP33_RS12310 (ORP33_12070) comGA 2405837..2406907 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  ORP33_RS12315 (ORP33_12075) - 2407120..2407317 (-) 198 WP_029726717.1 hypothetical protein -
  ORP33_RS12320 (ORP33_12080) corA 2407319..2408272 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=761262 ORP33_RS12285 WP_029726721.1 2403342..2403725(-) (comGF) [Bacillus subtilis strain K1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=761262 ORP33_RS12285 WP_029726721.1 2403342..2403725(-) (comGF) [Bacillus subtilis strain K1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969