Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   ORP33_RS12245 Genome accession   NZ_CP113256
Coordinates   2399276..2399449 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain K1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2394276..2404449
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ORP33_RS12230 (ORP33_11990) gcvT 2395076..2396164 (-) 1089 WP_080529534.1 glycine cleavage system aminomethyltransferase GcvT -
  ORP33_RS12235 (ORP33_11995) hepAA 2396605..2398278 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  ORP33_RS12240 (ORP33_12000) yqhG 2398299..2399093 (+) 795 WP_003230200.1 YqhG family protein -
  ORP33_RS12245 (ORP33_12005) sinI 2399276..2399449 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  ORP33_RS12250 (ORP33_12010) sinR 2399483..2399818 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ORP33_RS12255 (ORP33_12015) tasA 2399911..2400696 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  ORP33_RS12260 (ORP33_12020) sipW 2400760..2401332 (-) 573 WP_003230181.1 signal peptidase I SipW -
  ORP33_RS12265 (ORP33_12025) tapA 2401316..2402077 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  ORP33_RS12270 (ORP33_12030) yqzG 2402349..2402675 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  ORP33_RS12275 (ORP33_12035) spoIITA 2402717..2402896 (-) 180 WP_213414620.1 YqzE family protein -
  ORP33_RS12280 (ORP33_12040) comGG 2402967..2403341 (-) 375 WP_225722048.1 ComG operon protein ComGG Machinery gene
  ORP33_RS12285 (ORP33_12045) comGF 2403342..2403725 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  ORP33_RS12290 (ORP33_12050) comGE 2403751..2404098 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=761259 ORP33_RS12245 WP_003230187.1 2399276..2399449(+) (sinI) [Bacillus subtilis strain K1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=761259 ORP33_RS12245 WP_003230187.1 2399276..2399449(+) (sinI) [Bacillus subtilis strain K1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1