Detailed information    

insolico Bioinformatically predicted

Overview


Name   clpX   Type   Regulator
Locus tag   OTU45_RS08465 Genome accession   NZ_CP113114
Coordinates   1665563..1666795 (-) Length   410 a.a.
NCBI ID   WP_000106346.1    Uniprot ID   A0A064C077
Organism   Streptococcus pneumoniae strain NP1     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1620026..1676830 1665563..1666795 within 0


Gene organization within MGE regions


Location: 1620026..1676830
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTU45_RS08140 (OTU45_08140) - 1620026..1620982 (-) 957 WP_267740954.1 N-acetylmuramoyl-L-alanine amidase family protein -
  OTU45_RS08145 (OTU45_08145) - 1620986..1621318 (-) 333 WP_001186206.1 phage holin -
  OTU45_RS08150 (OTU45_08150) - 1621322..1621621 (-) 300 WP_001810279.1 hypothetical protein -
  OTU45_RS08155 (OTU45_08155) - 1621631..1621981 (-) 351 WP_000852244.1 hypothetical protein -
  OTU45_RS08160 (OTU45_08160) - 1621984..1622187 (-) 204 WP_001091123.1 hypothetical protein -
  OTU45_RS12105 - 1622168..1622285 (-) 118 Protein_1621 dihydrodipicolinate reductase -
  OTU45_RS08165 (OTU45_08165) - 1622282..1628638 (-) 6357 WP_267741165.1 tail fiber domain-containing protein -
  OTU45_RS08170 (OTU45_08170) - 1628643..1628993 (-) 351 WP_000068023.1 DUF6711 family protein -
  OTU45_RS08175 (OTU45_08175) - 1629002..1632595 (-) 3594 WP_267741197.1 hypothetical protein -
  OTU45_RS08180 (OTU45_08180) - 1632582..1632932 (-) 351 WP_000478016.1 hypothetical protein -
  OTU45_RS08185 (OTU45_08185) - 1632971..1633351 (-) 381 WP_001185639.1 DUF6096 family protein -
  OTU45_RS08190 (OTU45_08190) - 1633356..1633769 (-) 414 WP_000880674.1 phage tail tube protein -
  OTU45_RS08195 (OTU45_08195) - 1633772..1634140 (-) 369 WP_000608235.1 hypothetical protein -
  OTU45_RS08200 (OTU45_08200) - 1634137..1634652 (-) 516 WP_000015941.1 HK97-gp10 family putative phage morphogenesis protein -
  OTU45_RS08205 (OTU45_08205) - 1634627..1634965 (-) 339 WP_000478945.1 hypothetical protein -
  OTU45_RS08210 (OTU45_08210) - 1634946..1635257 (-) 312 WP_000021220.1 phage head-tail connector protein -
  OTU45_RS08215 (OTU45_08215) - 1635259..1635447 (-) 189 WP_000669352.1 hypothetical protein -
  OTU45_RS08220 (OTU45_08220) - 1635437..1635619 (-) 183 WP_050111708.1 Rho termination factor N-terminal domain-containing protein -
  OTU45_RS08225 (OTU45_08225) - 1635624..1636469 (-) 846 WP_000123893.1 N4-gp56 family major capsid protein -
  OTU45_RS08230 (OTU45_08230) - 1636475..1637059 (-) 585 WP_001288026.1 DUF4355 domain-containing protein -
  OTU45_RS08235 (OTU45_08235) - 1637286..1637537 (-) 252 WP_000890163.1 DUF6275 family protein -
  OTU45_RS08240 (OTU45_08240) - 1637539..1637802 (-) 264 WP_000877355.1 hypothetical protein -
  OTU45_RS08245 (OTU45_08245) - 1637845..1638258 (-) 414 WP_000565273.1 HD domain-containing protein -
  OTU45_RS08250 (OTU45_08250) - 1638255..1638464 (-) 210 WP_000651746.1 hypothetical protein -
  OTU45_RS08255 (OTU45_08255) - 1638466..1640103 (-) 1638 WP_164993540.1 minor capsid protein -
  OTU45_RS08260 (OTU45_08260) - 1640012..1641481 (-) 1470 WP_000285392.1 phage portal protein -
  OTU45_RS08265 (OTU45_08265) - 1641493..1642791 (-) 1299 WP_050111709.1 PBSX family phage terminase large subunit -
  OTU45_RS08270 (OTU45_08270) - 1642769..1643209 (-) 441 WP_001859583.1 terminase small subunit -
  OTU45_RS08280 (OTU45_08280) - 1643604..1644065 (-) 462 WP_001030245.1 DUF1492 domain-containing protein -
  OTU45_RS08285 (OTU45_08285) - 1644140..1644454 (-) 315 WP_050111710.1 hypothetical protein -
  OTU45_RS08290 (OTU45_08290) - 1644475..1644654 (-) 180 WP_001042650.1 hypothetical protein -
  OTU45_RS08295 (OTU45_08295) - 1644647..1645042 (-) 396 WP_000612393.1 YopX family protein -
  OTU45_RS08300 (OTU45_08300) - 1645186..1645308 (-) 123 WP_001859025.1 hypothetical protein -
  OTU45_RS08305 (OTU45_08305) - 1645347..1645853 (-) 507 WP_001041162.1 DUF1642 domain-containing protein -
  OTU45_RS08310 (OTU45_08310) - 1645855..1646167 (-) 313 Protein_1650 hypothetical protein -
  OTU45_RS08315 (OTU45_08315) - 1646318..1646656 (-) 339 WP_000119453.1 hypothetical protein -
  OTU45_RS08320 (OTU45_08320) - 1646656..1646808 (-) 153 WP_000122746.1 hypothetical protein -
  OTU45_RS08325 (OTU45_08325) - 1647102..1648445 (-) 1344 WP_267741732.1 virulence-associated E family protein -
  OTU45_RS08330 (OTU45_08330) - 1648448..1649269 (-) 822 WP_001838318.1 bifunctional DNA primase/polymerase -
  OTU45_RS08335 (OTU45_08335) - 1649442..1649948 (-) 507 WP_000054340.1 hypothetical protein -
  OTU45_RS08340 (OTU45_08340) - 1649968..1650795 (-) 828 WP_000885997.1 AAA family ATPase -
  OTU45_RS08345 (OTU45_08345) - 1650795..1651112 (-) 318 WP_001044592.1 hypothetical protein -
  OTU45_RS08350 (OTU45_08350) - 1651131..1652324 (-) 1194 WP_000028860.1 DEAD/DEAH box helicase family protein -
  OTU45_RS08355 (OTU45_08355) - 1652287..1652772 (-) 486 WP_000696056.1 hypothetical protein -
  OTU45_RS08360 (OTU45_08360) - 1652772..1653122 (-) 351 WP_224782710.1 hypothetical protein -
  OTU45_RS08365 (OTU45_08365) - 1653131..1653613 (-) 483 WP_000157807.1 siphovirus Gp157 family protein -
  OTU45_RS08370 (OTU45_08370) - 1653606..1654328 (-) 723 WP_000544344.1 HNH endonuclease signature motif containing protein -
  OTU45_RS08375 (OTU45_08375) - 1654342..1654572 (-) 231 WP_000252080.1 hypothetical protein -
  OTU45_RS08380 (OTU45_08380) - 1654573..1654914 (-) 342 WP_000189407.1 hypothetical protein -
  OTU45_RS08385 (OTU45_08385) - 1654926..1655114 (-) 189 WP_267741839.1 hypothetical protein -
  OTU45_RS08390 (OTU45_08390) - 1655114..1655308 (-) 195 WP_001050924.1 hypothetical protein -
  OTU45_RS08395 (OTU45_08395) - 1655305..1655577 (-) 273 WP_000388508.1 hypothetical protein -
  OTU45_RS08400 (OTU45_08400) - 1655820..1656356 (-) 537 WP_000446710.1 hypothetical protein -
  OTU45_RS08405 (OTU45_08405) - 1656388..1656603 (-) 216 WP_001198772.1 helix-turn-helix transcriptional regulator -
  OTU45_RS08410 (OTU45_08410) - 1656616..1656801 (-) 186 WP_023396929.1 helix-turn-helix domain-containing protein -
  OTU45_RS08415 (OTU45_08415) - 1656949..1657140 (+) 192 WP_000834623.1 hypothetical protein -
  OTU45_RS08420 (OTU45_08420) - 1657357..1658046 (+) 690 WP_000577241.1 DUF4145 domain-containing protein -
  OTU45_RS08425 (OTU45_08425) - 1658290..1659075 (+) 786 WP_407082878.1 helix-turn-helix domain-containing protein -
  OTU45_RS08430 (OTU45_08430) - 1659097..1660167 (+) 1071 WP_000420652.1 hypothetical protein -
  OTU45_RS08435 (OTU45_08435) - 1660537..1661664 (+) 1128 WP_050111715.1 tyrosine-type recombinase/integrase -
  OTU45_RS08440 (OTU45_08440) whiA 1661752..1662663 (-) 912 WP_000011306.1 DNA-binding protein WhiA -
  OTU45_RS08445 (OTU45_08445) - 1662660..1663637 (-) 978 WP_001231086.1 YvcK family protein -
  OTU45_RS08450 (OTU45_08450) rapZ 1663634..1664524 (-) 891 WP_000163035.1 RNase adapter RapZ -
  OTU45_RS08455 (OTU45_08455) - 1664576..1664956 (-) 381 WP_001140412.1 RidA family protein -
  OTU45_RS08460 (OTU45_08460) yihA 1664967..1665554 (-) 588 WP_000422597.1 ribosome biogenesis GTP-binding protein YihA/YsxC -
  OTU45_RS08465 (OTU45_08465) clpX 1665563..1666795 (-) 1233 WP_000106346.1 ATP-dependent Clp protease ATP-binding subunit ClpX Regulator
  OTU45_RS08470 (OTU45_08470) - 1666832..1667002 (-) 171 WP_000442258.1 hypothetical protein -
  OTU45_RS08475 (OTU45_08475) - 1667002..1667508 (-) 507 WP_267742105.1 dihydrofolate reductase -
  OTU45_RS08480 (OTU45_08480) - 1667638..1668156 (-) 519 WP_267742107.1 Dps family protein -
  OTU45_RS08485 (OTU45_08485) lytC 1668620..1670110 (-) 1491 WP_267742109.1 choline binding-anchored murein hydrolase LytC -
  OTU45_RS08490 (OTU45_08490) tpiA 1670148..1670906 (-) 759 WP_000087891.1 triose-phosphate isomerase -
  OTU45_RS08495 (OTU45_08495) - 1671005..1671682 (-) 678 WP_267742120.1 DnaD domain-containing protein -
  OTU45_RS08500 (OTU45_08500) metA 1671691..1672635 (-) 945 WP_001122714.1 homoserine O-acetyltransferase MetA -
  OTU45_RS08505 (OTU45_08505) - 1672817..1673329 (-) 513 WP_001049323.1 adenine phosphoribosyltransferase -
  OTU45_RS08510 (OTU45_08510) - 1673416..1674174 (-) 759 WP_001287230.1 class I SAM-dependent methyltransferase -
  OTU45_RS08515 (OTU45_08515) - 1674382..1674552 (+) 171 WP_000403101.1 hypothetical protein -
  OTU45_RS08520 (OTU45_08520) - 1674674..1675804 (-) 1131 WP_000229961.1 ABC transporter ATP-binding protein -
  OTU45_RS08530 (OTU45_08530) - 1676255..1676830 (-) 576 WP_000158722.1 cysteine hydrolase family protein -

Sequence


Protein


Download         Length: 410 a.a.        Molecular weight: 45798.35 Da        Isoelectric Point: 4.4550

>NTDB_id=760345 OTU45_RS08465 WP_000106346.1 1665563..1666795(-) (clpX) [Streptococcus pneumoniae strain NP1]
MSTNRKNDMMVYCSFCGKNQEEVQKIIAGNNAFICNECVELAQEIIREELVEEVLADLSEVPKPIELLHILNHYVIGQDR
AKRALAVAVYNHYKRINFHDTREESEDVDLQKSNILMIGPTGSGKTFLAQTLAKSLNVPFAIADATALTEAGYVGEDVEN
ILLKLLQVADFNIERAERGIIYVDEIDKIAKKSENVSITRDVSGEGVQQALLKIIEGTVASVPPQGGRKHPQQEMIQVDT
KNILFIVGGAFDGIEEIVKQRLGEKVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAALEQLTVDDLVR
ILKEPRNALVKQYQTLLSYDDVELEFDDEALQEIANKAIERKTGARGLRSIIEETMLDVMFEVPSQENVKLVRITKETVD
GTDKPILETA

Nucleotide


Download         Length: 1233 bp        

>NTDB_id=760345 OTU45_RS08465 WP_000106346.1 1665563..1666795(-) (clpX) [Streptococcus pneumoniae strain NP1]
ATGTCTACAAATAGAAAAAATGATATGATGGTTTATTGCTCATTTTGTGGCAAAAACCAAGAAGAAGTACAAAAAATAAT
TGCTGGCAACAATGCTTTTATTTGTAATGAATGCGTGGAGTTAGCTCAGGAAATCATTCGAGAAGAATTGGTTGAGGAAG
TCTTGGCAGACTTGTCTGAGGTGCCAAAACCAATTGAACTCCTCCATATCTTGAACCACTATGTAATTGGTCAAGATCGT
GCCAAGCGTGCCTTGGCAGTGGCGGTTTATAACCACTACAAACGCATCAATTTCCACGATACACGCGAAGAGTCAGAAGA
TGTGGATTTGCAGAAGTCAAACATTTTGATGATTGGCCCAACTGGTTCAGGGAAAACTTTCCTTGCCCAGACCTTGGCTA
AGAGCTTGAATGTACCTTTTGCTATTGCGGATGCGACAGCTCTGACGGAGGCTGGTTATGTGGGTGAGGATGTGGAAAAT
ATCCTCCTCAAACTCTTGCAGGTTGCTGACTTTAACATCGAACGTGCAGAGCGTGGCATTATCTATGTGGATGAAATTGA
CAAGATTGCCAAGAAGAGTGAGAATGTGTCTATCACACGTGATGTTTCTGGTGAAGGGGTGCAACAAGCCCTTCTCAAGA
TTATCGAGGGAACTGTTGCTAGCGTACCGCCTCAAGGTGGACGCAAACATCCACAACAAGAGATGATTCAAGTGGATACA
AAAAATATCCTCTTCATCGTGGGTGGTGCTTTTGATGGTATTGAAGAAATTGTCAAACAACGTCTGGGTGAAAAAGTCAT
CGGATTTGGTCAAAACAATAAGGCGATTGACGAAAACAGCTCATACATGCAAGAAATCATCGCTGAAGACATTCAAAAAT
TTGGTATTATCCCTGAGTTGATTGGACGCTTGCCTGTTTTTGCGGCTCTTGAGCAATTGACCGTTGATGACTTGGTTCGC
ATCTTGAAAGAGCCAAGAAATGCCTTGGTGAAACAATACCAAACCTTGCTTTCTTATGATGATGTTGAGTTGGAATTTGA
CGACGAAGCCCTTCAAGAGATTGCTAATAAAGCAATCGAACGGAAGACAGGGGCGCGTGGACTTCGCTCCATCATCGAAG
AAACCATGCTAGATGTTATGTTTGAGGTGCCGAGTCAGGAAAATGTGAAATTGGTTCGCATCACTAAAGAAACTGTCGAT
GGAACGGATAAACCGATCCTAGAAACAGCCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A064C077

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  clpX Streptococcus mutans UA159

86.585

100

0.866

  clpX Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819

57.214

98.049

0.561