Detailed information    

insolico Bioinformatically predicted

Overview

Name   cipB   Type   Regulator
Locus tag   OTU45_RS03120 Genome accession   NZ_CP113114
Coordinates   618988..619137 (+) Length   49 a.a.
NCBI ID   WP_001818346.1    Uniprot ID   -
Organism   Streptococcus pneumoniae strain NP1     
Function   indirect induction of ComX; activation of comRS system (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
IScluster/Tn 612382..618121 618988..619137 flank 867


Gene organization within MGE regions


Location: 612382..619137
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OTU45_RS03065 (OTU45_03065) - 612382..613335 (-) 954 WP_001155321.1 IS30-like element ISSpn8 family transposase -
  OTU45_RS12020 comA/nlmT 613588..614049 (-) 462 WP_309543754.1 ABC transporter transmembrane domain-containing protein Regulator
  OTU45_RS12025 comA/nlmT 613994..614581 (-) 588 WP_000205166.1 cysteine peptidase family C39 domain-containing protein Regulator
  OTU45_RS03075 (OTU45_03075) blpI 614895..615092 (+) 198 WP_001093259.1 bacteriocin-like peptide BlpI -
  OTU45_RS03080 (OTU45_03080) blpJ 615559..615828 (+) 270 WP_001093248.1 bacteriocin-like peptide BlpJ -
  OTU45_RS03085 (OTU45_03085) blpU 615897..616127 (+) 231 WP_000379967.1 bacteriocin-like peptide BlpU -
  OTU45_RS03090 (OTU45_03090) - 616130..616249 (+) 120 WP_000346296.1 PncF family bacteriocin immunity protein -
  OTU45_RS03095 (OTU45_03095) - 616548..616712 (+) 165 WP_000727118.1 hypothetical protein -
  OTU45_RS03100 (OTU45_03100) - 616709..617113 (+) 405 WP_000846944.1 hypothetical protein -
  OTU45_RS03105 (OTU45_03105) - 617316..618121 (+) 806 Protein_609 IS5 family transposase -
  OTU45_RS03110 (OTU45_03110) blpM 618271..618525 (+) 255 WP_000379879.1 two-peptide bacteriocin subunit BlpM -
  OTU45_RS03115 (OTU45_03115) blpN 618541..618744 (+) 204 WP_001099492.1 two-peptide bacteriocin subunit BlpN -
  OTU45_RS03120 (OTU45_03120) cipB 618988..619137 (+) 150 WP_001818346.1 bacteriocin-like peptide BlpO Regulator

Sequence

Protein


Download         Length: 49 a.a.        Molecular weight: 5134.91 Da        Isoelectric Point: 3.9133

>NTDB_id=760325 OTU45_RS03120 WP_001818346.1 618988..619137(+) (cipB) [Streptococcus pneumoniae strain NP1]
MDTKMMSQFAVMDNEMLACVEGGDIDWGRKISCAAGVAYGAIDGCATTV

Nucleotide


Download         Length: 150 bp        

>NTDB_id=760325 OTU45_RS03120 WP_001818346.1 618988..619137(+) (cipB) [Streptococcus pneumoniae strain NP1]
ATGGATACAAAAATGATGTCACAATTTGCAGTTATGGATAATGAAATGCTTGCTTGCGTTGAAGGTGGAGATATTGATTG
GGGAAGAAAAATTAGTTGTGCAGCAGGGGTTGCATATGGCGCAATTGATGGGTGTGCAACAACGGTTTGA

Domains

Predicted by InterproScan.

Bacteriocin class II with double-glycine leader peptide (Bacteriocin_IIc)

(6-44)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  cipB Streptococcus mutans UA159

51.02

100

0.51