Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   OVY33_RS10945 Genome accession   NZ_CP113107
Coordinates   2244070..2244948 (+) Length   292 a.a.
NCBI ID   WP_103358244.1    Uniprot ID   A0A2K3YNX8
Organism   Staphylococcus rostri strain PJFA-333     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2210357..2300465 2244070..2244948 within 0


Gene organization within MGE regions


Location: 2210357..2300465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OVY33_RS10790 fabG 2210492..2211229 (+) 738 WP_303350532.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  OVY33_RS10795 - 2211415..2211648 (+) 234 WP_044361001.1 acyl carrier protein -
  OVY33_RS10800 rnc 2211946..2212677 (+) 732 WP_103357333.1 ribonuclease III -
  OVY33_RS10805 smc 2212681..2216250 (+) 3570 WP_103357334.1 chromosome segregation protein SMC -
  OVY33_RS10810 ftsY 2216252..2217460 (+) 1209 WP_103357335.1 signal recognition particle-docking protein FtsY -
  OVY33_RS10815 - 2217447..2217779 (+) 333 WP_103357336.1 putative DNA-binding protein -
  OVY33_RS10820 ffh 2217793..2219160 (+) 1368 WP_103357337.1 signal recognition particle protein -
  OVY33_RS10825 rpsP 2219291..2219566 (+) 276 WP_044360994.1 30S ribosomal protein S16 -
  OVY33_RS10830 rimM 2219662..2220165 (+) 504 WP_103357338.1 ribosome maturation factor RimM -
  OVY33_RS10835 trmD 2220162..2220884 (+) 723 WP_103357339.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  OVY33_RS10840 rplS 2221001..2221351 (+) 351 WP_044360991.1 50S ribosomal protein L19 -
  OVY33_RS10845 - 2221535..2222725 (+) 1191 WP_309306524.1 XRE family transcriptional regulator -
  OVY33_RS10850 - 2223918..2224598 (+) 681 WP_103359005.1 ABC transporter ATP-binding protein -
  OVY33_RS10855 - 2224588..2225742 (+) 1155 WP_103359006.1 ABC transporter permease -
  OVY33_RS10860 - 2225739..2226359 (+) 621 WP_103359007.1 CPBP family intramembrane glutamic endopeptidase -
  OVY33_RS10865 - 2226370..2226786 (+) 417 WP_103359008.1 hypothetical protein -
  OVY33_RS10870 - 2227130..2229706 (-) 2577 WP_240624164.1 YfhO family protein -
  OVY33_RS10875 - 2229739..2230125 (-) 387 WP_303350502.1 GtrA family protein -
  OVY33_RS10880 - 2230295..2230432 (+) 138 WP_169926518.1 hypothetical protein -
  OVY33_RS10885 - 2230813..2232381 (+) 1569 WP_309306377.1 IS1182 family transposase -
  OVY33_RS10890 - 2232454..2234919 (-) 2466 WP_103358233.1 YfhO family protein -
  OVY33_RS10895 - 2235335..2237197 (+) 1863 WP_103358234.1 cation-translocating P-type ATPase -
  OVY33_RS10900 - 2237267..2237494 (+) 228 WP_103358235.1 heavy-metal-associated domain-containing protein -
  OVY33_RS10905 - 2237507..2237776 (+) 270 WP_206167753.1 hypothetical protein -
  OVY33_RS10910 - 2237813..2238466 (+) 654 WP_103358237.1 Crp/Fnr family transcriptional regulator -
  OVY33_RS10915 - 2238605..2239117 (+) 513 WP_309306525.1 NAD(P)H-dependent oxidoreductase -
  OVY33_RS10920 ylqF 2239406..2240287 (+) 882 WP_103358239.1 ribosome biogenesis GTPase YlqF -
  OVY33_RS10925 - 2240265..2241062 (+) 798 WP_309306526.1 ribonuclease HII -
  OVY33_RS10930 - 2241223..2241492 (+) 270 WP_103358241.1 hypothetical protein -
  OVY33_RS10935 sucC 2241821..2242987 (+) 1167 WP_103358242.1 ADP-forming succinate--CoA ligase subunit beta -
  OVY33_RS10940 sucD 2243008..2243916 (+) 909 WP_103358243.1 succinate--CoA ligase subunit alpha -
  OVY33_RS10945 dprA 2244070..2244948 (+) 879 WP_103358244.1 DNA-processing protein DprA Machinery gene
  OVY33_RS10950 topA 2245051..2247120 (+) 2070 WP_103358245.1 type I DNA topoisomerase -
  OVY33_RS10955 trmFO 2247144..2248451 (+) 1308 WP_103358246.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  OVY33_RS10960 xerC 2248570..2249460 (+) 891 WP_169926483.1 tyrosine recombinase XerC -
  OVY33_RS10965 hslV 2249468..2250010 (+) 543 WP_103358248.1 ATP-dependent protease subunit HslV -
  OVY33_RS10970 hslU 2250027..2251436 (+) 1410 WP_309306527.1 ATP-dependent protease ATPase subunit HslU -
  OVY33_RS10975 codY 2251451..2252224 (+) 774 WP_103358250.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  OVY33_RS10980 rpsB 2252388..2253158 (+) 771 WP_103358251.1 30S ribosomal protein S2 -
  OVY33_RS10985 tsf 2253246..2254124 (+) 879 WP_103358252.1 translation elongation factor Ts -
  OVY33_RS10990 pyrH 2254280..2255002 (+) 723 WP_103358253.1 UMP kinase -
  OVY33_RS10995 frr 2255022..2255576 (+) 555 WP_103358254.1 ribosome recycling factor -
  OVY33_RS11000 - 2255848..2256609 (+) 762 WP_103358255.1 isoprenyl transferase -
  OVY33_RS11005 - 2256624..2257406 (+) 783 WP_103358256.1 phosphatidate cytidylyltransferase -
  OVY33_RS11010 - 2257424..2258554 (+) 1131 WP_103358257.1 1-deoxy-D-xylulose-5-phosphate reductoisomerase -
  OVY33_RS11015 rseP 2258561..2259841 (+) 1281 WP_309306528.1 RIP metalloprotease RseP -
  OVY33_RS11020 - 2259869..2261572 (+) 1704 WP_103358259.1 proline--tRNA ligase -
  OVY33_RS11025 - 2261828..2266138 (+) 4311 WP_309306529.1 PolC-type DNA polymerase III -
  OVY33_RS11030 rimP 2266263..2266730 (+) 468 WP_103358261.1 ribosome maturation factor RimP -
  OVY33_RS11035 nusA 2266752..2267924 (+) 1173 WP_309306530.1 transcription termination factor NusA -
  OVY33_RS11040 rnpM 2267936..2268223 (+) 288 WP_103358263.1 RNase P modulator RnpM -
  OVY33_RS11045 - 2268220..2268528 (+) 309 WP_103358264.1 YlxQ family RNA-binding protein -
  OVY33_RS11050 infB 2268540..2270660 (+) 2121 WP_309306531.1 translation initiation factor IF-2 -
  OVY33_RS11055 - 2270822..2271124 (+) 303 WP_103358266.1 hypothetical protein -
  OVY33_RS11060 rbfA 2271228..2271572 (+) 345 WP_103358267.1 30S ribosome-binding factor RbfA -
  OVY33_RS11065 truB 2271672..2272589 (+) 918 WP_103358268.1 tRNA pseudouridine(55) synthase TruB -
  OVY33_RS11070 - 2272607..2273578 (+) 972 WP_103358269.1 bifunctional riboflavin kinase/FAD synthetase -
  OVY33_RS11075 rpsO 2273684..2273953 (+) 270 WP_103358270.1 30S ribosomal protein S15 -
  OVY33_RS11080 pnp 2274111..2276204 (+) 2094 WP_103358271.1 polyribonucleotide nucleotidyltransferase -
  OVY33_RS11085 - 2276540..2277145 (+) 606 WP_103358272.1 DUF6088 family protein -
  OVY33_RS11090 rnjB 2277438..2279111 (+) 1674 WP_309306532.1 ribonuclease J2 -
  OVY33_RS11095 - 2279258..2281621 (+) 2364 WP_309306533.1 DNA translocase FtsK -
  OVY33_RS11100 - 2281624..2282340 (+) 717 WP_103358275.1 GntR family transcriptional regulator -
  OVY33_RS11105 yfmF 2282360..2283631 (+) 1272 WP_373694257.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  OVY33_RS11110 yfmH 2283624..2284913 (+) 1290 WP_103358277.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  OVY33_RS11115 ymfI 2284910..2285611 (+) 702 WP_103358278.1 elongation factor P 5-aminopentanone reductase -
  OVY33_RS11120 - 2285660..2286499 (+) 840 WP_103358279.1 YmfK family protein -
  OVY33_RS11125 - 2286515..2286910 (+) 396 WP_103358280.1 RodZ family helix-turn-helix domain-containing protein -
  OVY33_RS11130 pgsA 2286949..2287533 (+) 585 WP_103358281.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  OVY33_RS11135 - 2287757..2288899 (+) 1143 WP_309306535.1 CinA family nicotinamide mononucleotide deamidase-related protein -
  OVY33_RS11140 recA 2289108..2290157 (+) 1050 WP_103358283.1 recombinase RecA Machinery gene
  OVY33_RS11145 rny 2290640..2292199 (+) 1560 WP_103358285.1 ribonuclease Y -
  OVY33_RS11150 - 2292558..2292932 (+) 375 WP_103358286.1 metalloregulator ArsR/SmtB family transcription factor -
  OVY33_RS11155 - 2292922..2295072 (+) 2151 WP_309306536.1 heavy metal translocating P-type ATPase -
  OVY33_RS11160 - 2295352..2296164 (+) 813 WP_103358288.1 TIGR00282 family metallophosphoesterase -
  OVY33_RS11165 - 2296385..2298145 (+) 1761 WP_103358289.1 2-oxoacid:acceptor oxidoreductase subunit alpha -
  OVY33_RS11170 - 2298146..2299012 (+) 867 WP_103358290.1 2-oxoacid:ferredoxin oxidoreductase subunit beta -
  OVY33_RS11175 - 2299177..2299353 (+) 177 WP_169926484.1 hypothetical protein -

Sequence


Protein


Download         Length: 292 a.a.        Molecular weight: 33415.40 Da        Isoelectric Point: 9.4710

>NTDB_id=760302 OVY33_RS10945 WP_103358244.1 2244070..2244948(+) (dprA) [Staphylococcus rostri strain PJFA-333]
MILTTRHLLLLLVYSGFTTRQIYNYFPHIMNYQGTKQDLTKQLTQDLSQYNDARIQAKLQRFINLDIRMIEQALTNGKID
AVSIDDARYPQLLKHIYDPPLILFSRGNLALLQHSRTLAIVGSRQHTHYTNQALNVLFPHFAKARLTIISGLANGADAIA
HEQAIQFGCNTIAVLGFGHFHHYPKQTQKLRHHIDTHFLSISEYPPYTRPAKFRFPERNRLISGLSQGVLITEAKERSGA
LITVDQALDQNRNVYVLPGDMFNPYTKGNMLRVQEGAEIVLTEMDILKDYCQ

Nucleotide


Download         Length: 879 bp        

>NTDB_id=760302 OVY33_RS10945 WP_103358244.1 2244070..2244948(+) (dprA) [Staphylococcus rostri strain PJFA-333]
ATGATTTTAACGACCCGCCACTTGTTGCTACTCCTTGTTTATAGCGGATTTACGACCCGTCAAATTTACAACTATTTCCC
TCATATTATGAACTATCAAGGCACAAAACAGGATCTTACAAAACAGCTCACTCAGGATTTATCACAATATAATGATGCAC
GCATACAAGCAAAGCTACAACGATTTATCAACTTGGACATTCGTATGATAGAACAGGCATTAACCAATGGGAAAATTGAT
GCCGTTAGTATTGACGACGCCCGCTATCCGCAGTTACTCAAGCATATTTATGATCCACCACTCATTCTTTTTTCTCGTGG
CAATTTAGCCCTTTTACAACATAGTCGCACGTTAGCTATTGTTGGTTCACGTCAGCATACACACTATACGAATCAAGCGT
TAAATGTGCTATTTCCTCATTTTGCCAAAGCGCGGTTAACAATCATTTCAGGATTAGCCAATGGTGCAGATGCCATTGCG
CATGAACAAGCAATCCAATTTGGTTGTAATACGATTGCAGTCTTAGGTTTCGGCCATTTTCATCACTATCCCAAACAAAC
ACAAAAGCTACGTCACCATATTGACACCCATTTTCTAAGTATTAGCGAATATCCTCCCTATACACGACCTGCCAAGTTTC
GTTTTCCCGAGCGCAATCGCCTGATTAGTGGTCTTTCACAAGGTGTGCTCATTACAGAAGCGAAAGAACGTAGTGGTGCA
TTGATTACTGTTGATCAAGCACTCGACCAAAATCGCAATGTATATGTTTTGCCCGGTGATATGTTTAATCCTTATACAAA
GGGGAACATGTTAAGGGTTCAAGAAGGGGCTGAAATCGTATTGACAGAAATGGATATTTTGAAAGATTATTGTCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A2K3YNX8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

50.35

97.945

0.493

  dprA Staphylococcus aureus N315

50.35

97.945

0.493