Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | OPU65_RS20040 | Genome accession | NZ_CP110812 |
| Coordinates | 3868750..3868890 (+) | Length | 46 a.a. |
| NCBI ID | WP_003184860.1 | Uniprot ID | P69890 |
| Organism | Bacillus paralicheniformis strain CamBx3 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3863750..3873890
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPU65_RS20015 (OPU65_20015) | - | 3863856..3864257 (+) | 402 | WP_265625791.1 | YueI family protein | - |
| OPU65_RS20020 (OPU65_20020) | - | 3864440..3864991 (+) | 552 | WP_026580053.1 | cysteine hydrolase family protein | - |
| OPU65_RS20025 (OPU65_20025) | - | 3865069..3866478 (+) | 1410 | WP_229029889.1 | nicotinate phosphoribosyltransferase | - |
| OPU65_RS20030 (OPU65_20030) | - | 3866656..3867876 (+) | 1221 | WP_265625792.1 | EAL and HDOD domain-containing protein | - |
| OPU65_RS20035 (OPU65_20035) | - | 3867917..3868264 (-) | 348 | WP_265625793.1 | hypothetical protein | - |
| OPU65_RS20040 (OPU65_20040) | degQ | 3868750..3868890 (+) | 141 | WP_003184860.1 | degradation enzyme regulation protein DegQ | Regulator |
| OPU65_RS20045 (OPU65_20045) | - | 3869079..3869990 (+) | 912 | WP_265625794.1 | polyprenyl synthetase family protein | - |
| OPU65_RS20050 (OPU65_20050) | comX | 3869962..3870132 (+) | 171 | WP_020452790.1 | competence pheromone ComX | - |
| OPU65_RS20055 (OPU65_20055) | comP | 3870153..3872468 (+) | 2316 | WP_025809738.1 | sensor histidine kinase | Regulator |
| OPU65_RS20060 (OPU65_20060) | comA | 3872555..3873193 (+) | 639 | WP_003184849.1 | response regulator transcription factor | Regulator |
| OPU65_RS20065 (OPU65_20065) | - | 3873210..3873599 (+) | 390 | WP_144498842.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5747.56 Da Isoelectric Point: 8.4596
>NTDB_id=756394 OPU65_RS20040 WP_003184860.1 3868750..3868890(+) (degQ) [Bacillus paralicheniformis strain CamBx3]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS
Nucleotide
Download Length: 141 bp
>NTDB_id=756394 OPU65_RS20040 WP_003184860.1 3868750..3868890(+) (degQ) [Bacillus paralicheniformis strain CamBx3]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTTGAAAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTTGAAAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
71.429 |
91.304 |
0.652 |