Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OPU65_RS20040 Genome accession   NZ_CP110812
Coordinates   3868750..3868890 (+) Length   46 a.a.
NCBI ID   WP_003184860.1    Uniprot ID   P69890
Organism   Bacillus paralicheniformis strain CamBx3     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3863750..3873890
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OPU65_RS20015 (OPU65_20015) - 3863856..3864257 (+) 402 WP_265625791.1 YueI family protein -
  OPU65_RS20020 (OPU65_20020) - 3864440..3864991 (+) 552 WP_026580053.1 cysteine hydrolase family protein -
  OPU65_RS20025 (OPU65_20025) - 3865069..3866478 (+) 1410 WP_229029889.1 nicotinate phosphoribosyltransferase -
  OPU65_RS20030 (OPU65_20030) - 3866656..3867876 (+) 1221 WP_265625792.1 EAL and HDOD domain-containing protein -
  OPU65_RS20035 (OPU65_20035) - 3867917..3868264 (-) 348 WP_265625793.1 hypothetical protein -
  OPU65_RS20040 (OPU65_20040) degQ 3868750..3868890 (+) 141 WP_003184860.1 degradation enzyme regulation protein DegQ Regulator
  OPU65_RS20045 (OPU65_20045) - 3869079..3869990 (+) 912 WP_265625794.1 polyprenyl synthetase family protein -
  OPU65_RS20050 (OPU65_20050) comX 3869962..3870132 (+) 171 WP_020452790.1 competence pheromone ComX -
  OPU65_RS20055 (OPU65_20055) comP 3870153..3872468 (+) 2316 WP_025809738.1 sensor histidine kinase Regulator
  OPU65_RS20060 (OPU65_20060) comA 3872555..3873193 (+) 639 WP_003184849.1 response regulator transcription factor Regulator
  OPU65_RS20065 (OPU65_20065) - 3873210..3873599 (+) 390 WP_144498842.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5747.56 Da        Isoelectric Point: 8.4596

>NTDB_id=756394 OPU65_RS20040 WP_003184860.1 3868750..3868890(+) (degQ) [Bacillus paralicheniformis strain CamBx3]
MEKQQIEELKQLLWRLENEIRETKDSLRKINKSIDQYDKYTYLKTS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=756394 OPU65_RS20040 WP_003184860.1 3868750..3868890(+) (degQ) [Bacillus paralicheniformis strain CamBx3]
GTGGAAAAGCAACAAATTGAAGAATTAAAACAACTGCTTTGGCGGCTTGAAAATGAAATCAGAGAAACAAAGGACTCCTT
GCGCAAGATTAACAAAAGCATTGATCAATACGATAAGTACACATATCTAAAAACCTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P69890

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

71.429

91.304

0.652