Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   LFL98_RS12490 Genome accession   NZ_CP110365
Coordinates   2416810..2417193 (-) Length   127 a.a.
NCBI ID   WP_015251713.1    Uniprot ID   -
Organism   Bacillus subtilis strain HY2-62     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2411810..2422193
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LFL98_RS12450 (LFL98_12455) sinI 2412744..2412917 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  LFL98_RS12455 (LFL98_12460) sinR 2412951..2413286 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LFL98_RS12460 (LFL98_12465) tasA 2413379..2414164 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  LFL98_RS12465 (LFL98_12470) sipW 2414228..2414800 (-) 573 WP_003246088.1 signal peptidase I -
  LFL98_RS12470 (LFL98_12475) tapA 2414784..2415545 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  LFL98_RS12475 (LFL98_12480) yqzG 2415817..2416143 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  LFL98_RS12480 (LFL98_12485) spoIIT 2416185..2416364 (-) 180 WP_029726723.1 YqzE family protein -
  LFL98_RS12485 (LFL98_12490) comGG 2416435..2416809 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  LFL98_RS12490 (LFL98_12495) comGF 2416810..2417193 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  LFL98_RS12495 (LFL98_12500) comGE 2417219..2417566 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  LFL98_RS12500 (LFL98_12505) comGD 2417550..2417981 (-) 432 WP_217011424.1 competence type IV pilus minor pilin ComGD Machinery gene
  LFL98_RS12505 (LFL98_12510) comGC 2417971..2418267 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  LFL98_RS12510 (LFL98_12515) comGB 2418281..2419318 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  LFL98_RS12515 (LFL98_12520) comGA 2419305..2420375 (-) 1071 WP_181217184.1 competence protein ComGA Machinery gene
  LFL98_RS12520 (LFL98_12525) corA 2420778..2421731 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14280.43 Da        Isoelectric Point: 6.4838

>NTDB_id=754626 LFL98_RS12490 WP_015251713.1 2416810..2417193(-) (comGF) [Bacillus subtilis strain HY2-62]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=754626 LFL98_RS12490 WP_015251713.1 2416810..2417193(-) (comGF) [Bacillus subtilis strain HY2-62]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992