Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LFL98_RS12450 Genome accession   NZ_CP110365
Coordinates   2412744..2412917 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain HY2-62     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2407744..2417917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LFL98_RS12435 (LFL98_12440) gcvT 2408543..2409631 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  LFL98_RS12440 (LFL98_12445) yqhH 2410073..2411746 (+) 1674 WP_004398544.1 SNF2-related protein -
  LFL98_RS12445 (LFL98_12450) yqhG 2411767..2412561 (+) 795 WP_003230200.1 YqhG family protein -
  LFL98_RS12450 (LFL98_12455) sinI 2412744..2412917 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  LFL98_RS12455 (LFL98_12460) sinR 2412951..2413286 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LFL98_RS12460 (LFL98_12465) tasA 2413379..2414164 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  LFL98_RS12465 (LFL98_12470) sipW 2414228..2414800 (-) 573 WP_003246088.1 signal peptidase I -
  LFL98_RS12470 (LFL98_12475) tapA 2414784..2415545 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  LFL98_RS12475 (LFL98_12480) yqzG 2415817..2416143 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  LFL98_RS12480 (LFL98_12485) spoIIT 2416185..2416364 (-) 180 WP_029726723.1 YqzE family protein -
  LFL98_RS12485 (LFL98_12490) comGG 2416435..2416809 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  LFL98_RS12490 (LFL98_12495) comGF 2416810..2417193 (-) 384 WP_015251713.1 ComG operon protein ComGF Machinery gene
  LFL98_RS12495 (LFL98_12500) comGE 2417219..2417566 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=754623 LFL98_RS12450 WP_003230187.1 2412744..2412917(+) (sinI) [Bacillus subtilis strain HY2-62]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=754623 LFL98_RS12450 WP_003230187.1 2412744..2412917(+) (sinI) [Bacillus subtilis strain HY2-62]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1