Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   OLM06_RS10850 Genome accession   NZ_CP110074
Coordinates   2175727..2176254 (-) Length   175 a.a.
NCBI ID   WP_264563336.1    Uniprot ID   -
Organism   Enterococcus faecalis strain BE5     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2145619..2192173 2175727..2176254 within 0


Gene organization within MGE regions


Location: 2145619..2192173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OLM06_RS10635 (OLM06_10620) - 2145619..2145945 (+) 327 WP_002362235.1 AzlD domain-containing protein -
  OLM06_RS10640 (OLM06_10625) - 2146200..2146685 (-) 486 WP_159110009.1 hypothetical protein -
  OLM06_RS10645 (OLM06_10630) - 2146943..2148850 (+) 1908 WP_169061620.1 class I SAM-dependent DNA methyltransferase -
  OLM06_RS10650 (OLM06_10635) - 2148834..2149883 (+) 1050 WP_169061621.1 restriction endonuclease subunit S -
  OLM06_RS10655 (OLM06_10640) - 2150067..2151152 (-) 1086 WP_264563332.1 SH3 domain-containing protein -
  OLM06_RS10660 (OLM06_10645) - 2151153..2151386 (-) 234 WP_002417568.1 phage holin -
  OLM06_RS10665 (OLM06_10650) - 2151379..2151600 (-) 222 WP_002374005.1 hypothetical protein -
  OLM06_RS10670 (OLM06_10655) - 2151635..2151790 (-) 156 WP_002364192.1 XkdX family protein -
  OLM06_RS10675 (OLM06_10660) - 2151792..2152112 (-) 321 WP_002389262.1 hypothetical protein -
  OLM06_RS10680 (OLM06_10665) - 2152126..2152617 (-) 492 WP_156208270.1 hypothetical protein -
  OLM06_RS10685 (OLM06_10670) - 2152617..2152904 (-) 288 WP_002357046.1 collagen-like protein -
  OLM06_RS10690 (OLM06_10675) - 2152901..2153497 (-) 597 WP_002357045.1 hypothetical protein -
  OLM06_RS10695 (OLM06_10680) - 2153490..2154371 (-) 882 WP_002357044.1 phage baseplate upper protein -
  OLM06_RS10700 (OLM06_10685) - 2154390..2157197 (-) 2808 WP_002384367.1 phage tail spike protein -
  OLM06_RS10705 (OLM06_10690) - 2157179..2157913 (-) 735 WP_002357042.1 hypothetical protein -
  OLM06_RS10710 (OLM06_10695) - 2157903..2160800 (-) 2898 WP_264563378.1 tape measure protein -
  OLM06_RS10715 (OLM06_10700) gpG 2161049..2161399 (-) 351 WP_025188244.1 phage tail assembly chaperone G -
  OLM06_RS10720 (OLM06_10705) - 2161452..2162294 (-) 843 WP_148251889.1 major tail protein -
  OLM06_RS10725 (OLM06_10710) - 2162295..2162669 (-) 375 WP_148251888.1 DUF6838 family protein -
  OLM06_RS10730 (OLM06_10715) - 2162673..2163071 (-) 399 WP_002402415.1 HK97 gp10 family phage protein -
  OLM06_RS10735 (OLM06_10720) - 2163064..2163441 (-) 378 WP_148251887.1 hypothetical protein -
  OLM06_RS10740 (OLM06_10725) - 2163438..2163782 (-) 345 WP_002411136.1 hypothetical protein -
  OLM06_RS10745 (OLM06_10730) - 2163791..2164027 (-) 237 WP_002372022.1 hypothetical protein -
  OLM06_RS10750 (OLM06_10735) - 2164051..2164953 (-) 903 WP_148251886.1 DUF5309 family protein -
  OLM06_RS10755 (OLM06_10740) - 2164967..2165593 (-) 627 WP_010823181.1 DUF4355 domain-containing protein -
  OLM06_RS10760 (OLM06_10745) - 2165812..2166132 (-) 321 WP_010823182.1 hypothetical protein -
  OLM06_RS10765 (OLM06_10750) - 2166190..2166420 (-) 231 WP_010823183.1 hypothetical protein -
  OLM06_RS10770 (OLM06_10755) - 2166421..2168205 (-) 1785 WP_148251885.1 head protein -
  OLM06_RS10775 (OLM06_10760) - 2168180..2169655 (-) 1476 WP_264563334.1 phage portal protein -
  OLM06_RS10780 (OLM06_10765) - 2169668..2170942 (-) 1275 WP_264563379.1 PBSX family phage terminase large subunit -
  OLM06_RS10785 (OLM06_10770) - 2170932..2171393 (-) 462 WP_264563335.1 terminase small subunit -
  OLM06_RS10790 (OLM06_10775) - 2171463..2171828 (-) 366 WP_002404563.1 hypothetical protein -
  OLM06_RS10795 (OLM06_10780) - 2172145..2172552 (-) 408 WP_002364505.1 transcriptional regulator -
  OLM06_RS10800 (OLM06_10785) - 2172553..2172765 (-) 213 WP_002411124.1 hypothetical protein -
  OLM06_RS10805 (OLM06_10790) - 2172769..2172969 (-) 201 WP_002411123.1 hypothetical protein -
  OLM06_RS10810 (OLM06_10795) - 2172970..2173458 (-) 489 WP_002411122.1 DUF1642 domain-containing protein -
  OLM06_RS10815 (OLM06_10800) - 2173470..2173748 (-) 279 WP_002411121.1 hypothetical protein -
  OLM06_RS10820 (OLM06_10805) - 2173894..2174292 (-) 399 WP_142665575.1 YopX family protein -
  OLM06_RS10825 (OLM06_10810) - 2174313..2174633 (-) 321 WP_010708007.1 hypothetical protein -
  OLM06_RS10830 (OLM06_10815) - 2174635..2175099 (-) 465 WP_025191277.1 class I SAM-dependent methyltransferase -
  OLM06_RS10835 (OLM06_10820) - 2175153..2175359 (-) 207 WP_142665576.1 hypothetical protein -
  OLM06_RS10840 (OLM06_10825) - 2175379..2175540 (-) 162 WP_251844122.1 hypothetical protein -
  OLM06_RS10845 (OLM06_10830) - 2175560..2175715 (-) 156 WP_251844121.1 hypothetical protein -
  OLM06_RS10850 (OLM06_10835) ssb 2175727..2176254 (-) 528 WP_264563336.1 single-stranded DNA-binding protein Machinery gene
  OLM06_RS10855 (OLM06_10840) - 2176244..2176552 (-) 309 WP_002381633.1 MazG-like family protein -
  OLM06_RS10860 (OLM06_10845) - 2176552..2177403 (-) 852 WP_264563380.1 DNA replication protein -
  OLM06_RS10865 (OLM06_10850) - 2177423..2178064 (-) 642 WP_264563337.1 putative HNHc nuclease -
  OLM06_RS10870 (OLM06_10855) - 2178069..2179085 (-) 1017 WP_264563338.1 ATP-binding protein -
  OLM06_RS10875 (OLM06_10860) - 2179097..2179576 (-) 480 WP_264563339.1 siphovirus Gp157 family protein -
  OLM06_RS10880 (OLM06_10865) - 2179560..2179682 (-) 123 WP_002399179.1 hypothetical protein -
  OLM06_RS10885 (OLM06_10870) - 2179767..2180069 (-) 303 WP_113813749.1 hypothetical protein -
  OLM06_RS10890 (OLM06_10875) - 2180177..2180350 (-) 174 WP_010716885.1 hypothetical protein -
  OLM06_RS10895 (OLM06_10880) - 2180362..2180547 (-) 186 WP_002411343.1 hypothetical protein -
  OLM06_RS10900 (OLM06_10885) - 2180558..2181271 (-) 714 WP_025188251.1 Rha family transcriptional regulator -
  OLM06_RS10905 (OLM06_10890) - 2181225..2181506 (-) 282 WP_002411341.1 hypothetical protein -
  OLM06_RS10910 (OLM06_10895) - 2181518..2181709 (-) 192 WP_002371609.1 hypothetical protein -
  OLM06_RS10915 (OLM06_10900) - 2181999..2182340 (+) 342 WP_002396425.1 helix-turn-helix domain-containing protein -
  OLM06_RS10920 (OLM06_10905) - 2182341..2182763 (+) 423 WP_002411340.1 ImmA/IrrE family metallo-endopeptidase -
  OLM06_RS10925 (OLM06_10910) - 2182849..2183583 (+) 735 WP_264563340.1 DUF4950 domain-containing protein -
  OLM06_RS10930 (OLM06_10915) - 2183597..2184211 (+) 615 WP_002411338.1 SHOCT domain-containing protein -
  OLM06_RS10935 (OLM06_10920) - 2184325..2185494 (+) 1170 WP_002411337.1 tyrosine-type recombinase/integrase -
  OLM06_RS10945 (OLM06_10930) - 2185850..2186086 (+) 237 WP_264563341.1 hypothetical protein -
  OLM06_RS10950 (OLM06_10935) - 2186160..2186432 (-) 273 WP_002381527.1 hypothetical protein -
  OLM06_RS10955 (OLM06_10940) upp 2186537..2187166 (-) 630 WP_002356624.1 uracil phosphoribosyltransferase -
  OLM06_RS10960 (OLM06_10945) glyA 2187298..2188536 (-) 1239 WP_002356623.1 serine hydroxymethyltransferase -
  OLM06_RS10965 (OLM06_10950) - 2188612..2189634 (-) 1023 WP_002400894.1 L-threonylcarbamoyladenylate synthase -
  OLM06_RS10970 (OLM06_10955) prmC 2189678..2190511 (-) 834 WP_002400896.1 peptide chain release factor N(5)-glutamine methyltransferase -
  OLM06_RS10975 (OLM06_10960) prfA 2190504..2191577 (-) 1074 WP_002356619.1 peptide chain release factor 1 -
  OLM06_RS10980 (OLM06_10965) - 2191589..2192173 (-) 585 WP_002356618.1 thymidine kinase -

Sequence

Protein


Download         Length: 175 a.a.        Molecular weight: 19347.26 Da        Isoelectric Point: 4.7521

>NTDB_id=752125 OLM06_RS10850 WP_264563336.1 2175727..2176254(-) (ssb) [Enterococcus faecalis strain BE5]
MINNVVLIGRLTKDIDLRYTASGSAVGSFTLAVNRNFTNQNGEREADFINCVIWRKPAETMANYARKGTLLGVVGRIQTR
NYDNQQGQRVYVTEVVCESFQLLESKSTNENRNSVQTSQDDGTSVQNDFEGKYTTNQNKGLNQQNNSKQMSFGGDVDPFA
GAGNSIDISADDLPF

Nucleotide


Download         Length: 528 bp        

>NTDB_id=752125 OLM06_RS10850 WP_264563336.1 2175727..2176254(-) (ssb) [Enterococcus faecalis strain BE5]
ATGATAAATAATGTGGTATTAATCGGAAGGCTGACGAAAGATATAGATTTACGCTACACCGCAAGTGGTTCTGCAGTTGG
AAGCTTTACTCTTGCTGTGAACCGTAATTTTACAAACCAAAACGGCGAACGAGAAGCGGATTTTATCAACTGTGTAATTT
GGCGTAAGCCTGCTGAAACAATGGCTAATTATGCTCGCAAAGGAACATTATTAGGAGTTGTTGGAAGAATTCAAACTCGT
AATTATGACAACCAACAAGGCCAACGTGTCTATGTGACTGAAGTTGTTTGCGAAAGCTTCCAATTATTAGAGTCAAAAAG
CACCAACGAGAATAGAAATAGCGTTCAGACGTCACAGGATGACGGTACAAGCGTTCAAAATGATTTCGAGGGTAAATATA
CCACAAATCAAAACAAAGGCTTAAATCAGCAAAATAACAGCAAACAAATGTCGTTTGGCGGAGATGTAGATCCGTTTGCA
GGTGCAGGTAATTCAATCGACATTAGCGCCGATGATCTGCCGTTCTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

56.915

100

0.611
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.429

100

0.554